GM130/GOLGA2 Recombinant Protein Antigen

Images

 
There are currently no images for GM130/GOLGA2 Recombinant Protein Antigen (NBP1-89756PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

GM130/GOLGA2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GOLGA2.

Source: E. coli

Amino Acid Sequence: GDSVCGETHRALQGAMEKLQSRFMELMQEKADLKERVEELEHRCIQLSGETDTIGEYIALYQSQRAVLKERHREKE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GOLGA2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89756.It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GM130/GOLGA2 Recombinant Protein Antigen

  • 130 kDa cis-Golgi matrix protein
  • GM130 autoantigen
  • GM130
  • GM130Golgi matrix protein GM130
  • GOLGA2
  • golgi autoantigen, golgin subfamily a, 2
  • golgin A2
  • Golgin subfamily A member 2
  • Golgin-95
  • MGC20672
  • SY11 Protein

Background

Golgi Matrix Protein (GM130) is peripheral cytoplamic protein that is bound to the Golgi membranes. It has been implicated as a maintainer of cis-Golgi structure (1). During mitosis, it regulates the disassembly and reassembly of the Golgi complex. It is also linked to docking and fusion of coatomer (COP I) coated vesicles to the Golgi membrane (2). The COOH-terminal domain of GM130 is highly homologous to Golgi human auto-antigen, golgin-95. GM130 interacts specifically and GTP-dependent manner with Rab1b protein, a regulator of anterograde traffic between ER and Golgi membranes (3). GM130 is also activator of YSK1, an essential player in cell migration.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22321
Species: Hu
Applications: ICC/IF, IP, WB
NBP3-38014
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-88527
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-02665
Species: Ca, Hu, Pm, Po, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-75515
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-P, WB
NBP1-49643
Species: Bv, Hu, Pm
Applications: Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, KO, WB
NBP1-55113
Species: Hu, Pm, Mu
Applications: IHC, IHC-P, WB
NBP1-91953
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-87035
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-80789
Species: Hu
Applications: IHC, IHC-P, KD, WB
NBP2-38528
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-36568
Species: Hu, Mu
Applications: Flow-IC, ICC/IF, IHC, IHC-P, WB
H00008826-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, S-ELISA, WB
NBP1-89747
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-85729
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-83352
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
H00009527-B01P
Species: Hu
Applications: ICC/IF, WB
AF5687
Species: Hu, Rt
Applications: ICC, IHC, Simple Western, WB
NBP2-15578
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89756PEP
Species: Hu
Applications: AC

Publications for GM130/GOLGA2 Recombinant Protein Antigen (NBP1-89756PEP) (0)

There are no publications for GM130/GOLGA2 Recombinant Protein Antigen (NBP1-89756PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GM130/GOLGA2 Recombinant Protein Antigen (NBP1-89756PEP) (0)

There are no reviews for GM130/GOLGA2 Recombinant Protein Antigen (NBP1-89756PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GM130/GOLGA2 Recombinant Protein Antigen (NBP1-89756PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GM130/GOLGA2 Products

Research Areas for GM130/GOLGA2 Recombinant Protein Antigen (NBP1-89756PEP)

Find related products by research area.

Blogs on GM130/GOLGA2

There are no specific blogs for GM130/GOLGA2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GM130/GOLGA2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GOLGA2