GM-CSFR alpha Antibody

Images

 
Western Blot: GM-CSFR alpha Antibody [H00001438-B01P] - Analysis of CSF2RA expression in transfected 293T cell line by CSF2RA polyclonal antibody. Lane 1: CSF2RA transfected lysate(44 KDa). Lane 2: Non-transfected ...read more
Flow Cytometry: GM-CSFR alpha Antibody [H00001438-B01P] - Analysis of negative control 293 cells (Black) and CSF2RA expressing 293 cells (Green) using CSF2RA purified mouse polyclonal antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, Flow
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

GM-CSFR alpha Antibody Summary

Description
Quality control test: Antibody reactive against mammalian transfected lysate.
Immunogen
CSF2RA (NP_006131.2, 1 a.a. - 400 a.a.) full-length human protein. MLLLVTSLLLCELPHPAFLLIPEKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSDDGNLGSVYIYVLLIVGTLVCGIVLGFLFKRFLRIQRLFPPVPQIKDKLNDNHEVEDEIIWEEFTPEEGKGYREEVLTVKEIT
Specificity
CSF2RA - colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage),
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
CSF2RA
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Flow Cytometry
  • Western Blot 1:500
Application Notes
Antibody reactivity against transfected lysate for WB. It has been used for ELISA and FACS analysis.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GM-CSFR alpha Antibody

  • CD116 antigen
  • CD116
  • CDw116
  • colony stimulating factor 2 receptor alpha subunit
  • colony stimulating factor 2 receptor, alpha, low-affinity(granulocyte-macrophage)
  • CSF2R
  • CSF2RA
  • CSF2RAX
  • CSF2RAY
  • CSF2RX
  • CSF2RY
  • GM-CSF R alpha
  • GM-CSF receptor alpha subunit
  • GMCSFR alpha
  • GMCSFR
  • GM-CSFRa
  • GM-CSF-R-alpha
  • GMCSFR-alpha
  • GMR
  • GMR-alpha
  • granulocyte-macrophage colony-stimulating factor receptor alpha chain
  • granulocyte-macrophage colony-stimulating factor receptor subunit alpha
  • MGC3848
  • MGC4838

Background

The protein encoded by this gene is the alpha subunit of the heterodimeric receptor for colony stimulating factor 2, a cytokine which controls the production, differentiation, and function of granulocytes and macrophages. The encoded protein is a member of the cytokine family of receptors. This gene is found in the pseudoautosomal region (PAR) of the X and Y chromosomes. Multiple transcript variants encoding different isoforms have been found for this gene, with some of the isoforms being membrane-bound and others being soluble. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

7954-GM/CF
Species: Hu
Applications: BA
7954-GM/CF
Species: Hu
Applications: BA
203-IL
Species: Hu
Applications: BA
NBP2-59451
Species: Hu
Applications: ELISA, Flow, ICC/IF, MiAr, WB
DDX0300P-100
Species: Ca, Hu
Applications: Flow, IHC, IHC-Fr, IHC-P, IP, WB
M5000
Species: Mu
Applications: ELISA
AF1356
Species: Hu, Mu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
255-SC
Species: Hu
Applications: BA
NB600-1071
Species: Hu(-), Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
6507-IL/CF
Species: Hu
Applications: BA
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
7268-CT
Species: Hu
Applications: BA
NBP2-93743
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
DC140
Species: Hu
Applications: ELISA
M6000B
Species: Mu
Applications: ELISA
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP2-02434
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB

Publications for GM-CSFR alpha Antibody (H00001438-B01P) (0)

There are no publications for GM-CSFR alpha Antibody (H00001438-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GM-CSFR alpha Antibody (H00001438-B01P) (0)

There are no reviews for GM-CSFR alpha Antibody (H00001438-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GM-CSFR alpha Antibody (H00001438-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GM-CSFR alpha Products

Diseases for GM-CSFR alpha Antibody (H00001438-B01P)

Discover more about diseases related to GM-CSFR alpha Antibody (H00001438-B01P).
 

Pathways for GM-CSFR alpha Antibody (H00001438-B01P)

View related products by pathway.

PTMs for GM-CSFR alpha Antibody (H00001438-B01P)

Learn more about PTMs related to GM-CSFR alpha Antibody (H00001438-B01P).
 

Research Areas for GM-CSFR alpha Antibody (H00001438-B01P)

Find related products by research area.

Blogs on GM-CSFR alpha

There are no specific blogs for GM-CSFR alpha, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GM-CSFR alpha Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CSF2RA
Entrez
Uniprot