GM-CSFR alpha Antibody Summary
Immunogen |
CSF2RA (NP_006131.2, 1 a.a. - 400 a.a.) full-length human protein. MLLLVTSLLLCELPHPAFLLIPEKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSDDGNLGSVYIYVLLIVGTLVCGIVLGFLFKRFLRIQRLFPPVPQIKDKLNDNHEVEDEIIWEEFTPEEGKGYREEVLTVKEIT |
Specificity |
CSF2RA - colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage), |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Mouse |
Gene |
CSF2RA |
Purity |
Protein A purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Flow Cytometry
- Western Blot 1:500
|
Application Notes |
Antibody reactivity against transfected lysate for WB. It has been used for ELISA and FACS analysis. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.4) |
Preservative |
No Preservative |
Purity |
Protein A purified |
Notes
Quality control test: Antibody reactive against mammalian transfected lysate.
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for GM-CSFR alpha Antibody
Background
The protein encoded by this gene is the alpha subunit of the heterodimeric receptor for colony stimulating factor 2, a cytokine which controls the production, differentiation, and function of granulocytes and macrophages. The encoded protein is a member of the cytokine family of receptors. This gene is found in the pseudoautosomal region (PAR) of the X and Y chromosomes. Multiple transcript variants encoding different isoforms have been found for this gene, with some of the isoforms being membrane-bound and others being soluble. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA, Flow, ICC/IF, MiAr, WB
Species: Ca, Hu
Applications: Flow, IHC, IHC-Fr, IHC-P, IP, WB
Species: Mu
Applications: ELISA
Species: Hu, Mu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu(-), Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Publications for GM-CSFR alpha Antibody (H00001438-B01P) (0)
There are no publications for GM-CSFR alpha Antibody (H00001438-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GM-CSFR alpha Antibody (H00001438-B01P) (0)
There are no reviews for GM-CSFR alpha Antibody (H00001438-B01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for GM-CSFR alpha Antibody (H00001438-B01P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional GM-CSFR alpha Products
Bioinformatics Tool for GM-CSFR alpha Antibody (H00001438-B01P)
Discover related pathways, diseases and genes to GM-CSFR alpha Antibody (H00001438-B01P). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for GM-CSFR alpha Antibody (H00001438-B01P)
Discover more about diseases related to GM-CSFR alpha Antibody (H00001438-B01P).
| | Pathways for GM-CSFR alpha Antibody (H00001438-B01P)
View related products by pathway.
|
PTMs for GM-CSFR alpha Antibody (H00001438-B01P)
Learn more about PTMs related to GM-CSFR alpha Antibody (H00001438-B01P).
| | Research Areas for GM-CSFR alpha Antibody (H00001438-B01P)
Find related products by research area.
|
Blogs on GM-CSFR alpha