Glyoxalase II/HAGH Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HAGH. Source: E. coli
Amino Acid Sequence: CGKFYEGTADEMCKALLEVLGRLPPDTRVYCGHEYTINNLKFARHVEPGNAAIREKL Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
HAGH |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38909. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
24 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for Glyoxalase II/HAGH Recombinant Protein Antigen
Background
HAGH, also known as Hydroxyacylglutathione hydrolase mitochondrial, has a 308 amino acid long isoform that is 34 kDa and located in the mitochondrion matrix and a short 260 amino acid isoform that is 29 kDa and located in the cytoplasm; is classified as a thiolesterase and is responsible for the hydrolysis of S-lactoyl-glutathione to reduced glutathione and D-lactate. Studies are being performed on the relationship of this protein to glyoxalase ii deficiency, breast carcinoma, carcinoma, familial Mediterranean fever, muscular dystrophy, thrombocytosis, neisseria meningitides, hyperglycemia, bladder carcinoma, alzheimer's disease, prostate cancer, hepatitis b, and prostatitis. HAGH protein involvement has been observed with relation to pyruvate metabolism, secondary metabolite metabolism, methylglyoxal degradation, and (R)-lactate from methylglyoxal pathways where it interacts with MYOC, PRDX2, VPS72, SOD1, and DR1.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC-P, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: EM, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Mu
Applications: IA, ICC/IF, IHC, IHC-Fr, IP, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: AC
Publications for Glyoxalase II/HAGH Recombinant Protein Antigen (NBP2-38909PEP) (0)
There are no publications for Glyoxalase II/HAGH Recombinant Protein Antigen (NBP2-38909PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Glyoxalase II/HAGH Recombinant Protein Antigen (NBP2-38909PEP) (0)
There are no reviews for Glyoxalase II/HAGH Recombinant Protein Antigen (NBP2-38909PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for Glyoxalase II/HAGH Recombinant Protein Antigen (NBP2-38909PEP) (0)
Additional Glyoxalase II/HAGH Products
Research Areas for Glyoxalase II/HAGH Recombinant Protein Antigen (NBP2-38909PEP)
Find related products by research area.
|
Blogs on Glyoxalase II/HAGH