GLYCTK Recombinant Protein Antigen (NBP1-83292PEP)

Images

 
There are currently no images for GLYCTK Protein (NBP1-83292PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

GLYCTK Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GLYCTK.

Source: E.coli

Amino Acid Sequence: IRAAMERAGKQEMLLKPHSRVQVFEGAEDNLPDRDALRAALAIQQLAEGLTADDLLLVLISGGGSALLPAPIPPVTLEEKQTLTRLLAARGATIQELNTIRKALSQLKGGGLAQAAYPAQVVSLILSDVVG

Protein/Peptide Type
Recombinant Protein Antigen
Gene
GLYCTK
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-83292.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related protocol, click here.
Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GLYCTK Recombinant Protein Antigen

  • EC 2.7.1.31
  • glycerate kinase
  • GLYCTK1
  • HBeAg-binding protein 2
  • HBeAg-binding protein 4
  • HBeAgBP4A
  • HBEBP2
  • HBEBP4HBeAg binding protein 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-57033
Species: Hu
Applications: WB
NBP1-47778
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02639
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF1936
Species: Hu
Applications: WB, IP
NBP2-01506
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-32398
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-02164
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF1970
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-54755
Species: Hu
Applications: WB
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-54825
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31241
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-53164
Species: Hu
Applications: WB
NB100-74340
Species: Hu, Mu, Rt, Bv, ChHa, Dr, Fu, Pl, Pr, Rb, Sh, Xp, Ye, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-89559
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31470
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-25147
Species: Hu, Mu, Rt, Bv, Xp
Applications: WB, Simple Western, ICC/IF
NBP2-14080
Species: Hu
Applications: WB, IHC, IHC-P

Publications for GLYCTK Protein (NBP1-83292PEP) (0)

There are no publications for GLYCTK Protein (NBP1-83292PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GLYCTK Protein (NBP1-83292PEP) (0)

There are no reviews for GLYCTK Protein (NBP1-83292PEP). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

FAQs for GLYCTK Protein (NBP1-83292PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GLYCTK Products

Related Products by Gene

Bioinformatics Tool for GLYCTK Protein (NBP1-83292PEP)

Discover related pathways, diseases and genes to GLYCTK Protein (NBP1-83292PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GLYCTK Protein (NBP1-83292PEP)

Discover more about diseases related to GLYCTK Protein (NBP1-83292PEP).

Blogs on GLYCTK

There are no specific blogs for GLYCTK, but you can read our latest blog posts.

Customers Who Bought This Also Bought

GLYCTK Antibody
NBP1-83292
GLYCTK Antibody
NBP1-83292
GLYCTK Antibody
NBP1-83292

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GLYCTK Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GLYCTK