We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

GLYCTK Recombinant Protein Antigen

Images

 
There are currently no images for GLYCTK Protein (NBP1-83292PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

GLYCTK Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GLYCTK.

Source: E. coli

Amino Acid Sequence: IRAAMERAGKQEMLLKPHSRVQVFEGAEDNLPDRDALRAALAIQQLAEGLTADDLLLVLISGGGSALLPAPIPPVTLEEKQTLTRLLAARGATIQELNTIRKALSQLKGGGLAQAAYPAQVVSLILSDVVG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GLYCTK
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83292.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GLYCTK Recombinant Protein Antigen

  • EC 2.7.1.31
  • glycerate kinase
  • GLYCTK1
  • HBeAg-binding protein 2
  • HBeAg-binding protein 4
  • HBeAgBP4A
  • HBEBP2
  • HBEBP4HBeAg binding protein 4

Background

GLYCTK, also known as Glycerate kinase, has 7 isoforms, a 523 amino acid isoform 1 that is 55 kDa, a 234 amino acid isoform 2 that is 25 k Da, a 457 amino acid isoform 3 that is 48 kDa, a 367 amino acid isoform 4 that is 39 kDa, a 240 amino acid isoform 5 that is 25 kDa, a 205 amino acid isoform 6 that is 22 kDa, and a 187 amino acid isoform 7 that is 20 kDa; acts as a catalyzer of the phosphorylation of (R)-glycerate and may be involved in serine degradation and fructose metabolism. This protein is being studied for its involvement in microcephaly and seizures. GLYCTK has been linked to glycine, serine and threonine metabolism, glycerolipid metabolism, and glyoxylate and dicarboxylate metabolism pathways where interacts with TRIP13, ALDH1B1, ALDH2, ALDH7A1, and GRHPR proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-15687
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-47778
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-85790
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
AF1936
Species: Hu
Applications: IP, WB
NBP2-01506
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-32398
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, KD, WB
NBP1-81838
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-02164
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-52983
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP3-05078
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-36776
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NB200-540
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr,  IHC-P, IP
H00005105-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IP, WB
NBP2-33606
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
H00051179-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NB100-74340
Species: Bv, ChHa, Dr, Fu, Hu, Mu, Pl, Pr, Rb, Rt, Sh, Xp, Ye, Ze
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP1-89559
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-31470
Species: Bv, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
H00002023-M01
Species: Fe, Hu
Applications: ELISA, Flow, Func, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-14080
Species: Hu
Applications: IHC,  IHC-P, WB

Publications for GLYCTK Protein (NBP1-83292PEP) (0)

There are no publications for GLYCTK Protein (NBP1-83292PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GLYCTK Protein (NBP1-83292PEP) (0)

There are no reviews for GLYCTK Protein (NBP1-83292PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GLYCTK Protein (NBP1-83292PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GLYCTK Products

Research Areas for GLYCTK Protein (NBP1-83292PEP)

Find related products by research area.

Blogs on GLYCTK

There are no specific blogs for GLYCTK, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GLYCTK Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GLYCTK