Glycine N-Methyltransferase/GNMT Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Glycine N-Methyltransferase/GNMT Antibody [NBP1-89512] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemistry-Paraffin: Glycine N-Methyltransferase/GNMT Antibody [NBP1-89512] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine cells.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Glycine N-Methyltransferase/GNMT Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EEANWMTLDKDVPQSAEGGFDAVICLGNSFAHLPDCKGDQSEHRLALKNIASMVRAGGLLVIDHRNY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GNMT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Glycine N-Methyltransferase/GNMT Protein (NBP1-89512PEP)
Publications
Read Publication using NBP1-89512.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%). Reactivity reported in scientific literature (PMID: 23997240)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Glycine N-Methyltransferase/GNMT Antibody

  • EC 2.1.1.20
  • Glycine NMethyltransferase
  • Glycine N-Methyltransferase
  • GNMT

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00000875-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P, IP, RNAi
AF6466
Species: Hu
Applications: WB
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-55120
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87098
Species: Hu
Applications: IHC, IHC-P
NBP2-37607
Species: Hu, Rt
Applications: WB, ELISA, IHC
NB100-791
Species: Hu
Applications: WB, IHC, PEP-ELISA
NBP2-13980
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-128
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P
NBP1-59580
Species: Hu, Rt
Applications: WB
MAB5646
Species: Hu
Applications: WB, Flow, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-14036
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56519
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, IHC-FrFl
NBP2-02563
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-89512
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for Glycine N-Methyltransferase/GNMT Antibody (NBP1-89512)(1)

Reviews for Glycine N-Methyltransferase/GNMT Antibody (NBP1-89512) (0)

There are no reviews for Glycine N-Methyltransferase/GNMT Antibody (NBP1-89512). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Glycine N-Methyltransferase/GNMT Antibody (NBP1-89512) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Glycine N-Methyltransferase/GNMT Products

Bioinformatics Tool for Glycine N-Methyltransferase/GNMT Antibody (NBP1-89512)

Discover related pathways, diseases and genes to Glycine N-Methyltransferase/GNMT Antibody (NBP1-89512). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Glycine N-Methyltransferase/GNMT Antibody (NBP1-89512)

Discover more about diseases related to Glycine N-Methyltransferase/GNMT Antibody (NBP1-89512).
 

Pathways for Glycine N-Methyltransferase/GNMT Antibody (NBP1-89512)

View related products by pathway.

PTMs for Glycine N-Methyltransferase/GNMT Antibody (NBP1-89512)

Learn more about PTMs related to Glycine N-Methyltransferase/GNMT Antibody (NBP1-89512).

Blogs on Glycine N-Methyltransferase/GNMT

There are no specific blogs for Glycine N-Methyltransferase/GNMT, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Glycine N-Methyltransferase/GNMT Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GNMT
Entrez