Glycine N-Methyltransferase/GNMT Antibody

Immunocytochemistry/Immunofluorescence: Glycine N-Methyltransferase/GNMT Antibody [NBP1-89512] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.

Immunohistochemistry-Paraffin: Glycine N-Methyltransferase/GNMT Antibody [NBP1-89512] - Staining in human pancreas and colon tissues using anti-GNMT antibody. Corresponding GNMT RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Glycine N-Methyltransferase/GNMT Antibody [NBP1-89512] - Staining of human colon shows low expression as expected.

Immunohistochemistry-Paraffin: Glycine N-Methyltransferase/GNMT Antibody [NBP1-89512] - Staining of human pancreas shows high expression.

• Reactivity: Hu, Rt
• Applications: ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Glycine N-Methyltransferase/GNMT Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EEANWMTLDKDVPQSAEGGFDAVICLGNSFAHLPDCKGDQSEHRLALKNIASMVRAGGLLVIDHRNY
• Predicted Species: Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GNMT
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Glycine N-Methyltransferase/GNMT Protein (NBP1-89512PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%). Reactivity reported in scientific literature (PMID: 23997240)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Glycine N-Methyltransferase/GNMT Antibody

• EC 2.1.1.20
• Glycine NMethyltransferase
• Glycine N-Methyltransferase
• GNMT

Background

GNMT is encoded by this gene is an enzyme that catalyzes the conversion of S-adenosyl-L-methionine (along with glycine) to S-adenosyl-L-homocysteine and sarcosine. The encoded protein is found in the cytoplasm and acts as a homotetramer. Defects in this gene are a cause of GNMT deficiency (hypermethioninemia).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Glycine N-Methyltransferase/GNMT Antibody (NBP1-89512)(1)

Publication using NBP1-89512

• Ottaviani S, Brooke GN, O'Hanlon-Brown C et al. Characterisation of the androgen regulation of glycine N-methyltransferase in prostate cancer cells. J Mol Endocrinol 2013-12-01 [PMID: 23997240]

Bioinformatics

• Gene Symbol: GNMT