Glycerol Kinase Blocking Peptide

Images

 
There are currently no images for Glycerol Kinase Protein (NBP1-57033PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC
Concentration
LYOPH

Order Details

Glycerol Kinase Blocking Peptide Summary

Description
A peptide corresponding to amino acids from the middle region of human Glycerol Kinase. Accession #: NP_976325.

Source: Synthetic

Amino Acid Sequence: MAAGAAEGVGVWSLEPEDLSAVTMERFEPQINAEESEIRYSTWKKAVMKS

Source
Synthetic
Protein/Peptide Type
Blocking Peptide
Gene
GK
Purity
N/A

Applications/Dilutions

Application Notes
This is a synthetic peptide designed for use in combination with anti-GK Antibody NBP1-57033.
Theoretical MW
58 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
Lyophilized with sterile distilled water.
Preservative
No Preservative
Concentration
LYOPH
Purity
N/A
Reconstitution Instructions
Add 100ul of sterile PBS. Final peptide concentration will be 1 mg/ml in PBS.

Notes

For longer periods of storage, aliquot and store at -20C. Avoid repeat freeze-thaw cycles.

Alternate Names for Glycerol Kinase Blocking Peptide

  • ATP:glycerol 3-phosphotransferase
  • EC 2.7.1.30
  • GK
  • GK1
  • GKD
  • glpK
  • Glycerokinase
  • Glycerol Kinase

Background

The product of this gene belongs to the FGGY kinase family of proteins and encodes glycerol kinase. Glycerol kinase is a key enzyme in the regulation of glycerol uptake and metabolism. It catalyzes the phosphorylation of glycerol by ATP, yielding ADP and glycerol-3-phosphate. Defects in this gene are the cause of glycerol kinase deficiency (GKD). Alternatively spliced transcript variants encoding different isoforms have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-47778
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80533
Species: Mu
Applications: WB
PP-H7431-00
Species: Hu
Applications: WB
NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-03396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22218
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31241
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
NBP2-57614
Species: Hu
Applications: ICC/IF
NBP1-90367
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00594
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-69565
Species: Hu
Applications: WB, IHC, IHC-P
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-12793
Species: Hu, Mu
Applications: WB, IP
NBP1-57033PEP
Species: Hu
Applications: AC

Publications for Glycerol Kinase Protein (NBP1-57033PEP) (0)

There are no publications for Glycerol Kinase Protein (NBP1-57033PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Glycerol Kinase Protein (NBP1-57033PEP) (0)

There are no reviews for Glycerol Kinase Protein (NBP1-57033PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for Glycerol Kinase Protein (NBP1-57033PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Glycerol Kinase Products

Bioinformatics Tool for Glycerol Kinase Protein (NBP1-57033PEP)

Discover related pathways, diseases and genes to Glycerol Kinase Protein (NBP1-57033PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Glycerol Kinase Protein (NBP1-57033PEP)

Discover more about diseases related to Glycerol Kinase Protein (NBP1-57033PEP).
 

Pathways for Glycerol Kinase Protein (NBP1-57033PEP)

View related products by pathway.

PTMs for Glycerol Kinase Protein (NBP1-57033PEP)

Learn more about PTMs related to Glycerol Kinase Protein (NBP1-57033PEP).

Blogs on Glycerol Kinase

There are no specific blogs for Glycerol Kinase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-2 [Unconjugated]
202-IL-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Glycerol Kinase Blocking Peptide and receive a gift card or discount.

Bioinformatics

Gene Symbol GK
Entrez