Glycerol Kinase Antibody Blocking Peptide Summary
| Description |
A human Glycerol Kinase antibody blocking peptide. Source: Synthetic Amino Acid Sequence: (Accession #: NP_976325)MAAGAAEGVGVWSLEPEDLSAVTMERFEPQINAEESEIRYSTWKKAVMKS
For longer periods of storage, aliquot and store at -20C. Avoid repeat freeze-thaw cycles. |
| Source |
Synthetic |
| Protein/Peptide Type |
Antibody Blocking Peptide |
| Gene |
GK |
| Purity |
N/A |
Applications/Dilutions
| Dilutions |
- Antibody Competition
- Western Blot
|
| Application Notes |
This peptide is useful as a blocking peptide for NBP1-57033. This synthetic peptide is designed for use in an antibody competition assay with its corresponding antibody. Use of this product in any other assay has not yet been tested.For further blocking peptide related protocol, click here. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
Lyophilized with sterile distilled water. |
| Preservative |
No Preservative |
| Concentration |
LYOPH |
| Purity |
N/A |
| Reconstitution Instructions |
Reconstitute with 100ul of sterile PBS for a final peptide concentration of 1 mg/ml. |
Alternate Names for Glycerol Kinase Antibody Blocking Peptide
Background
The product of this gene belongs to the FGGY kinase family of proteins and encodes glycerol kinase. Glycerol kinase is a key enzyme in the regulation of glycerol uptake and metabolism. It catalyzes the phosphorylation of glycerol by ATP, yielding ADP and glycerol-3-phosphate. Defects in this gene are the cause of glycerol kinase deficiency (GKD). Alternatively spliced transcript variants encoding different isoforms have been identified.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
Species: Hu
Applications: BA
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: WB, AC
Publications for Glycerol Kinase Protein (NBP1-57033PEP) (0)
There are no publications for Glycerol Kinase Protein (NBP1-57033PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Glycerol Kinase Protein (NBP1-57033PEP) (0)
There are no reviews for Glycerol Kinase Protein (NBP1-57033PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Glycerol Kinase Protein (NBP1-57033PEP) (0)
Additional Glycerol Kinase Products
Research Areas for Glycerol Kinase Protein (NBP1-57033PEP)
Find related products by research area.
|
Blogs on Glycerol Kinase