GLYATL1 Antibody - BSA Free

Western Blot: GLYATL1 Antibody [NBP2-84985] - Host: Rabbit. Target Name: GLYL1. Sample Type: COLO205 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

GLYATL1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GLYATL1 Antibody - BSA Free (NBP2-84985) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human GLYATL1. Peptide sequence: SKSVKVEHSRALLLVTEDILKLNASSKSKLGSWAETGHPDDEFESETPNF The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GLYATL1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for GLYATL1 Antibody - BSA Free

• Acyl-CoA:glycine N-acyltransferase-like protein 1
• EC 2.3.1.13
• FLJ26507
• FLJ34646
• GATF-C
• glycine N-acyltransferase-like protein 1
• glycine-N-acyltransferase-like 1
• GNAT
• MGC15397
• MGC15937

Background

Mitochondrial acyltransferase which transfers the acyl group to the N-terminus of glycine. Can conjugate amultitude of substrates to form a variety of N-acylglycines

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GLYATL1