GNPNAT1 Antibody

Images

 
Western Blot: GNPNAT1 Antibody [NBP1-83842] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: GNPNAT1 Antibody [NBP1-83842] - Staining of human liver shows strong cytoplasmic and nuclear positivity in hepatocytes.
Western Blot: GNPNAT1 Antibody [NBP1-83842] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GNPNAT1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TPMFDPSLLKEVDWSQNTATFSPAISPTHPGEGLVLRPLCTADLNRGFFKVLGQLTETGVVSPEQFMKSFEHMKKSGDYYVTVVEDVTLGQIVATATLIIEHKFIHSCAKRGRVEDVVVSDECRGKQLGKLLLSTLTLLSKKLNCYKITLECLPQNVGFYKKFGYTVSEE
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GNPNAT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GNPNAT1 Protein (NBP1-83842PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GNPNAT1 Antibody

  • EC 2.3.1.4
  • FLJ10607
  • glucosamine 6-phosphate N-acetyltransferase
  • glucosamine-phosphate N-acetyltransferase 1
  • GNA1
  • GNPNAT
  • Gpnat1
  • Phosphoglucosamine acetylase
  • Phosphoglucosamine transacetylase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-11433
Species: Hu, Pm, Mu, Rt, Ye
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-32728
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-89750
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP1-32600
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-03734
Species: Hu, Pm, Mu, Pm, Rt
Applications: Flow, IHC, IHC-P, WB
NBP2-24653
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-02541
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-00990
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67627
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00054763-M03
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NB110-40591
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
664-LI/CF
Species: Hu
Applications: BA
NBP1-81838
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-43760
Species: Hu, Mu
Applications: ICC/IF, IHC-Fr, IHC-P, WB
NB7276
Species: Ch
Applications: ELISA, ICC/IF, IHC, IHC-P, WB

Publications for GNPNAT1 Antibody (NBP1-83842) (0)

There are no publications for GNPNAT1 Antibody (NBP1-83842).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GNPNAT1 Antibody (NBP1-83842) (0)

There are no reviews for GNPNAT1 Antibody (NBP1-83842). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GNPNAT1 Antibody (NBP1-83842) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GNPNAT1 Products

Bioinformatics Tool for GNPNAT1 Antibody (NBP1-83842)

Discover related pathways, diseases and genes to GNPNAT1 Antibody (NBP1-83842). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GNPNAT1 Antibody (NBP1-83842)

Discover more about diseases related to GNPNAT1 Antibody (NBP1-83842).
 

Pathways for GNPNAT1 Antibody (NBP1-83842)

View related products by pathway.

PTMs for GNPNAT1 Antibody (NBP1-83842)

Learn more about PTMs related to GNPNAT1 Antibody (NBP1-83842).

Blogs on GNPNAT1

There are no specific blogs for GNPNAT1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GNPNAT1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GNPNAT1