Glutathione S Transferase kappa 1 Antibody [DyLight 650]

• Reactivity: Hu
• Applications: ELISA, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: DyLight 650

Glutathione S Transferase kappa 1 Antibody [DyLight 650] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-226 of human Glutathione S Transferase kappa 1 (NP_057001.1).
  
  Sequence:
  MGPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPAVNARL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GSTK1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Notes

DyLight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.

Alternate Names for Glutathione S Transferase kappa 1 Antibody [DyLight 650]

• EC 2.5.1.18
• glutathione S-transferase k1
• glutathione S-transferase kappa 1
• glutathione S-transferase subunit 13 homolog
• Glutathione S-transferase subunit 13
• GST 13-13
• GST class-kappa
• GST
• GST13
• GST13-13
• GSTK1-1
• hGSTK1

Background

Glutathione transferases (GSTs) are a superfamily of enzymes that play a vital functional role in the cellular detoxification process. They catalyze the conjugation of the thiol group of glutathione (GSH) to the electrophilic groups of a wide range of hydrophobic substrates, leading to an easier removal of the latter from the cells (1) The Kappa class of GSTs comprises soluble enzymes originally isolated from the mitochondrial matrix of rats. Gsk1 catalyses some typical GST reactions, it has been proposed that it is structurally distinct from other classes of cytosolic GSTs (2). Gsk1 has been identified in rat, mouse, and human. The C terminus of Gsk1 was essential for localization of the protein to peroxisomes, and the C-terminal sequence Ala-Arg-Leu represents a peroxisome targeting signal (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GSTK1