Recombinant Human Glutamate Receptor 4 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Glutamate Receptor 4 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-433 of Human GRIA4 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MRIISRQIVLLFSGFWGLAMGAFPSSVQIGGLFIRNTDQEYTAFRLAIFLHNTSPNASEAPFNLVPHVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITPSFPTEGESQFVLQLRPSLRGALLSLLDHYEWNCFVFLYDTDRGYSILQAIMEKAGQNGWHVSAICVENFNDVSYRQLLEELDRRQEKKFVIDCEIERLQNILEQIVSVGKHVKGYHYIIANLGFKDISLERFIHGGANVTGFQLVDFNTPMVIKLMDRWKKLDQREYPGSETPPKYTSALTYDGVLVMAETFRSLRRQKIDISRRGNAGDCLANPAAPWGQGIDMERTLKQVRIQGLTGNVQFDHYGRRVNYTMDVFELKSTGPRKVGYWNDMDKLVLIQDVPTLGNDTAAIENRTVVVTTIMPLMKNPILRN

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
GRIA4
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Glutamate Receptor 4 Protein

  • AMPA-selective glutamate receptor 4
  • GluA4
  • GluR4
  • gluR-4
  • GLUR4C
  • GLUR4gluR-D
  • GLURD
  • GluR-D
  • glutamate receptor 4
  • Glutamate receptor ionotropic, AMPA 4
  • glutamate receptor, ionotrophic, AMPA 4

Background

Glutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. These receptors are heteromeric protein complexes composed of multiple subunits, arranged to form ligand-gated ion channels. The classification of glutamate receptors is based on their activation by different pharmacologic agonists. The subunit encoded by this gene belongs to a family of AMPA (alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate)-sensitive glutamate receptors, and is subject to RNA editing (AGA->GGA; R->G). Alternative splicing of this gene results in transcript variants encoding different isoforms, which may vary in their signal transduction properties. Some haplotypes of this gene show a positive association with schizophrenia. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

PPS050
Species: Hu, Mu, Rt, Ch, Pm, Ze
Applications: WB
PPS007
Species: Hu, Mu, Rt, Ca, Ch
Applications: WB
NB300-124
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP2-37584
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NLS3208
Species: Hu, Po, Bv, Eq, Mk, Pm
Applications: WB, IHC-P, ICC
NB300-118
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC-Fr, IHC-P, IP, IF
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-45856
Species: Hu
Applications: WB, IHC, IF
NBP1-91946
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB300-105
Species: Hu, Mu, Rt, Rb
Applications: WB, IHC, IHC-P, IP
NBP1-76849
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-76853
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB300-106
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IP
NBP1-91856
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-76852
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF2180
Species: Hu
Applications: WB, Simple Western, IP
NBP2-50048
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF
NLS921
Species: Hu, Bv
Applications: WB, IHC-P, ICC
NB120-11427
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00002893-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for Glutamate Receptor 4 Recombinant Protein (H00002893-P01) (0)

There are no publications for Glutamate Receptor 4 Recombinant Protein (H00002893-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Glutamate Receptor 4 Recombinant Protein (H00002893-P01) (0)

There are no reviews for Glutamate Receptor 4 Recombinant Protein (H00002893-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Glutamate Receptor 4 Recombinant Protein (H00002893-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Glutamate Receptor 4 Products

Bioinformatics Tool for Glutamate Receptor 4 Recombinant Protein (H00002893-P01)

Discover related pathways, diseases and genes to Glutamate Receptor 4 Recombinant Protein (H00002893-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Glutamate Receptor 4 Recombinant Protein (H00002893-P01)

Discover more about diseases related to Glutamate Receptor 4 Recombinant Protein (H00002893-P01).
 

Pathways for Glutamate Receptor 4 Recombinant Protein (H00002893-P01)

View related products by pathway.

PTMs for Glutamate Receptor 4 Recombinant Protein (H00002893-P01)

Learn more about PTMs related to Glutamate Receptor 4 Recombinant Protein (H00002893-P01).

Blogs on Glutamate Receptor 4

There are no specific blogs for Glutamate Receptor 4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

NMDAR2B Antibody
NB300-106-100ul

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Glutamate Receptor 4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GRIA4
Entrez