Glut5 Antibody

Immunohistochemistry-Paraffin: Glut5 Antibody [NBP1-89761] - Staining in human testis and pancreas tissues using NBP1-89761 antibody. Corresponding SLC2A5 RNA-seq data are presented for the same tissues.

Western Blot: Glut5 Antibody [NBP1-89761] - Analysis in control (vector only transfected HEK293T lysate) and sLC2A5 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: Glut5 Antibody [NBP1-89761] - Staining of human duodenum shows strong positivity in apical membrane in glandular cells.

Immunohistochemistry-Paraffin: Glut5 Antibody [NBP1-89761] - Staining of human kidney shows strong positivity in luminal membrane in cells in tubules.

Immunohistochemistry-Paraffin: Glut5 Antibody [NBP1-89761] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Immunohistochemistry-Paraffin: Glut5 Antibody [NBP1-89761] - Staining of human testis shows strong membranous positivity in cells in seminiferous ducts.

• Reactivity: Hu
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Glut5 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KALQTLRGWDSVDREVAEIRQEDEAEKAAGFISVLKLFRMRSLRWQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC2A5
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Glut5 Protein (NBP1-89761PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (83%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Glut5 Antibody

• Fructose transporter
• Glucose transporter type 5, small intestine
• Glut5
• GLUT-5
• GLUT5glucose transporter-like protein 5
• SLC2A5
• solute carrier family 2 (facilitated glucose transporter), member 5
• solute carrier family 2 (facilitated glucose/fructose transporter), member 5
• solute carrier family 2, facilitated glucose transporter member 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC2A5