Glut5 Antibody


Western Blot: Glut5 Antibody [NBP1-89761] - Analysis in control (vector only transfected HEK293T lysate) and sLC2A5 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T more
Immunohistochemistry-Paraffin: Glut5 Antibody [NBP1-89761] - Staining in human duodenum and pancreas tissues using anti-SLC2A5 antibody. Corresponding SLC2A5 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Glut5 Antibody [NBP1-89761] - Staining of human duodenum shows high expression.
Immunohistochemistry-Paraffin: Glut5 Antibody [NBP1-89761] - Staining of human pancreas shows low expression as expected.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

Glut5 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: KALQTLRGWDSVDREVAEIRQEDEAEKAAGFISVLKLFRMRSLRWQ
Specificity of human Glut5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Glut5 Protein (NBP1-89761PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (83%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Glut5 Antibody

  • Fructose transporter
  • Glucose transporter type 5, small intestine
  • Glut5
  • GLUT-5
  • GLUT5glucose transporter-like protein 5
  • SLC2A5
  • solute carrier family 2 (facilitated glucose transporter), member 5
  • solute carrier family 2 (facilitated glucose/fructose transporter), member 5
  • solute carrier family 2, facilitated glucose transporter member 5


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Rb
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-IC
Species: Hu
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: Simple Western, IHC, IHC-P
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, B/N
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Glut5 Antibody (NBP1-89761) (0)

There are no publications for Glut5 Antibody (NBP1-89761).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Glut5 Antibody (NBP1-89761) (0)

There are no reviews for Glut5 Antibody (NBP1-89761). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Glut5 Antibody (NBP1-89761) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for Glut5 Antibody (NBP1-89761)

Discover related pathways, diseases and genes to Glut5 Antibody (NBP1-89761). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Glut5 Antibody (NBP1-89761)

Discover more about diseases related to Glut5 Antibody (NBP1-89761).

Pathways for Glut5 Antibody (NBP1-89761)

View related products by pathway.

PTMs for Glut5 Antibody (NBP1-89761)

Learn more about PTMs related to Glut5 Antibody (NBP1-89761).

Blogs on Glut5

There are no specific blogs for Glut5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Glut5 Antibody and receive a gift card or discount.


Gene Symbol SLC2A5