GLUT12 Antibody

Images

 
Western Blot: GLUT12 Antibody [NBP3-10448] - Western blot analysis of GLUT12 in Mouse Spleen as a positive control. Antibody dilution at 0.2-1 ug/ml

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GLUT12 Antibody Summary

Immunogen
The immunogen is a synthetic peptide corresponding to a region of Mouse (NP_849265). Peptide sequence VLFIPETKGCSLEQISVELAKANYVKNNICFMSHHQEELVPTQLQKRKPQ
Clonality
Polyclonal
Host
Rabbit
Gene
SLC2A12
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
67 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS buffer, 2% sucrose.
Preservative
0.09% Sodium Azide
Purity
Affinity purified

Alternate Names for GLUT12 Antibody

  • GLUT12
  • GLUT-12
  • GLUT12GLUT8Glucose transporter type 12
  • SLC2A12
  • solute carrier family 2 (facilitated glucose transporter), member 12
  • solute carrier family 2, facilitated glucose transporter member 12

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-39113
Species: Hu, Mu, Rb, Rt
Applications: ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, Simple Western, WB
NBP1-49533
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB
NBP1-59812
Species: Hu
Applications: WB
NBP2-66872
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP2-33382
Species: Hu
Applications: IHC, IHC-P
NBP1-47980
Species: Hu, Pm
Applications: Flow, IHC, IHC-P, IP, WB
NBP2-22218
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-47987
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-12262
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP1-05054
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-38748
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-34062
Species: Hu
Applications: IHC, IHC-P, WB
NB600-607
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
MAB3304
Species: Hu
Applications: CyTOF-ready, ICC, ICFlow
NB400-114
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP3-10448
Species: Mu
Applications: WB

Publications for GLUT12 Antibody (NBP3-10448) (0)

There are no publications for GLUT12 Antibody (NBP3-10448).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GLUT12 Antibody (NBP3-10448) (0)

There are no reviews for GLUT12 Antibody (NBP3-10448). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GLUT12 Antibody (NBP3-10448) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GLUT12 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC2A12