GLUT12 Antibody - BSA Free

Western Blot: GLUT12 Antibody [NBP3-10448] - Western blot analysis of GLUT12 in Mouse Spleen as a positive control. Antibody dilution at 0.2-1 ug/ml

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

GLUT12 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GLUT12 Antibody - BSA Free (NBP3-10448) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse (NP_849265). Peptide sequence VLFIPETKGCSLEQISVELAKANYVKNNICFMSHHQEELVPTQLQKRKPQ
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC2A12
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 67 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for GLUT12 Antibody - BSA Free

• GLUT12
• GLUT-12
• GLUT12GLUT8Glucose transporter type 12
• SLC2A12
• solute carrier family 2 (facilitated glucose transporter), member 12
• solute carrier family 2, facilitated glucose transporter member 12

Background

SLC2A12 belongs to a family of transporters that catalyze the uptake of sugars through facilitated diffusion (Rogers et al., 2002). This family of transporters show conservation of 12 transmembrane helices as well as functionally significant amino acid residues (Joost and Thorens, 2001 [PubMed 11780753]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC2A12