We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Glucose 6 phosphate isomerase Recombinant Protein Antigen

Images

 
There are currently no images for Glucose 6 phosphate isomerase Recombinant Protein Antigen (NBP2-58524PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Glucose 6 phosphate isomerase Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Glucose 6 phosphate isomerase.

Source: E. coli

Amino Acid Sequence: VINIGIGGSDLGPLMVTEALKPYSSGGPRVWYVSNIDGTHIAKTLAQLNPESSLFIIASKTFTTQETITNAETAKEWFLQAAKDPSAVAKHFVALST

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GPI
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58524.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Glucose 6 phosphate isomerase Recombinant Protein Antigen

  • AMFGNPI
  • Autocrine motility factor
  • DKFZp686C13233
  • EC 5.3.1.9
  • glucose phosphate isomerase
  • glucose-6-phosphate isomerase
  • hexose monophosphate isomerase
  • hexosephosphate isomerase
  • neuroleukin
  • NLKSA36
  • oxoisomerase
  • PGI
  • PHI
  • Phosphoglucose isomerase
  • phosphohexomutase
  • Phosphohexose isomerase
  • phosphosaccharomutase
  • SA-36
  • Sperm antigen 36
  • sperm antigen-36

Background

Glucose 6 phosphate isomerase belongs to the GPI family whose members encode multifunctional phosphoglucose isomerase proteins involved in energy pathways. The protein encoded by this gene is a dimeric enzyme that catalyzes the reversible isomerization of glucose-6-phosphate and fructose-6-phosphate. The protein functions in different capacities inside and outside the cell. In the cytoplasm, the gene product is involved in glycolysis and gluconeogenesis, while outside the cell it functions as a neurotrophic factor for spinal and sensory neurons. Defects in this gene are the cause of nonspherocytic hemolytic anemia and a severe enzyme deficiency can be associated with hydrops fetalis, immediate neonatal death and neurological impairment.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46349
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-31589
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-32398
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, KD, WB
NBP1-89559
Species: Hu
Applications: IHC,  IHC-P, WB
NBP3-05078
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF2009
Species: Hu
Applications: ICC, IHC
NB500-330
Species: Hu
Applications: B/N, CyTOF-ready, Flow, IHC, IHC-Fr,  IHC-P, IP
NB100-236
Species: Hu, Mu
Applications: IB, IHC, IHC-Fr, WB
NB100-56605
Species: Av, Bv, Sh
Applications: WB
7268-CT
Species: Hu
Applications: BA
NB100-689
Species: Hu, Rt
Applications: IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP3-48740
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-67503
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-32259
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
NBP2-02043
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-13760
Species: Hu
Applications: IHC,  IHC-P
NBP2-58524PEP
Species: Hu
Applications: AC

Publications for Glucose 6 phosphate isomerase Recombinant Protein Antigen (NBP2-58524PEP) (0)

There are no publications for Glucose 6 phosphate isomerase Recombinant Protein Antigen (NBP2-58524PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Glucose 6 phosphate isomerase Recombinant Protein Antigen (NBP2-58524PEP) (0)

There are no reviews for Glucose 6 phosphate isomerase Recombinant Protein Antigen (NBP2-58524PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Glucose 6 phosphate isomerase Recombinant Protein Antigen (NBP2-58524PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Glucose 6 phosphate isomerase Products

Research Areas for Glucose 6 phosphate isomerase Recombinant Protein Antigen (NBP2-58524PEP)

Find related products by research area.

Blogs on Glucose 6 phosphate isomerase

There are no specific blogs for Glucose 6 phosphate isomerase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Glucose 6 phosphate isomerase Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GPI