GLTSCR2 Antibody (5A8)

Images

 
Immunocytochemistry/ Immunofluorescence: GLTSCR2 Antibody (5A8) [H00029997-M03] - Analysis of monoclonal antibody to GLTSCR2 on HeLa cell. Antibody concentration 10 ug/ml
ELISA: GLTSCR2 Antibody (5A8) [H00029997-M03] - Detection limit for recombinant GST tagged GLTSCR2 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
5A8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

GLTSCR2 Antibody (5A8) Summary

Immunogen
GLTSCR2 (NP_056525, 402 a.a. ~ 478a.a) partial recombinant protein with GST tag.KPRRLGRLKYQAPDIDVQLSSELTDSLRTLKPEGNILRDRFK SFQRRNMIEPRERAKFKRKYKVKLVEKRAFREIQL
Localization
Nucleus, nucleolus.
Specificity
GLTSCR2 - glioma tumor suppressor candidate region gene 2
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GLTSCR2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Publications
Read Publications using
H00029997-M03 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GLTSCR2 Antibody (5A8)

  • glioma tumor suppressor candidate region gene 2 protein
  • glioma tumor suppressor candidate region gene 2
  • p60
  • PICT1
  • PICT-1
  • protein interacting with carboxyl terminus 1

Background

Interacts with HSV-1 early proteins ICP22 and ICP0.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
AF771
Species: Mu
Applications: WB, IHC, Neut
NBP2-15939
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-81404
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF2065
Species: Mu
Applications: WB, Simple Western, ICC
NBP1-87431
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-71687
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-80965
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84545
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-33090
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
H00029997-M03
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for GLTSCR2 Antibody (H00029997-M03)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for GLTSCR2 Antibody (H00029997-M03) (0)

There are no reviews for GLTSCR2 Antibody (H00029997-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GLTSCR2 Antibody (H00029997-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GLTSCR2 Products

Bioinformatics Tool for GLTSCR2 Antibody (H00029997-M03)

Discover related pathways, diseases and genes to GLTSCR2 Antibody (H00029997-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GLTSCR2 Antibody (H00029997-M03)

Discover more about diseases related to GLTSCR2 Antibody (H00029997-M03).
 

Pathways for GLTSCR2 Antibody (H00029997-M03)

View related products by pathway.

PTMs for GLTSCR2 Antibody (H00029997-M03)

Learn more about PTMs related to GLTSCR2 Antibody (H00029997-M03).
 

Research Areas for GLTSCR2 Antibody (H00029997-M03)

Find related products by research area.

Blogs on GLTSCR2

There are no specific blogs for GLTSCR2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GLTSCR2 Antibody (5A8) and receive a gift card or discount.

Bioinformatics

Gene Symbol GLTSCR2
Entrez
OMIM
Uniprot