GLS2 Antibody [Janelia Fluor® 549]

Product Discontinued

GLS2 Antibody [Janelia Fluor® 549] Summary

• Immunogen: Synthetic peptides corresponding to GLS2(glutaminase 2 (liver, mitochondrial)) The peptide sequence was selected from the middle region of GLS2. Peptide sequence FVGKEPSGLRYNKLSLNEEGIPHNPMVNAGAIVVSSLIKMDCNKAEKFDF. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GLS2
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Sold under license from the Howard Hughes Medical Institute, Janelia Research Campus.

Alternate Names for GLS2 Antibody [Janelia Fluor® 549]

• EC 3.5.1.2
• GAbreast cell glutaminase
• GLSglutaminase GA
• glutaminase 2 (liver, mitochondrial)
• glutaminase I
• glutaminase liver isoform, mitochondrial
• hLGA
• LGA
• L-glutaminase
• L-glutamine amidohydrolase
• MGC71567
• phosphate-activated glutaminase
• phosphate-dependent glutaminase
• truncated glutaminase 2

Background

The protein encoded by the GLS2 gene is a mitochondrial phosphate-activated glutaminase that catalyzes the hydrolysis of glutamine to stoichiometric amounts of glutamate and ammonia. This protein is functionally similar to the kidney glutaminase but is a little smaller in size. Originally thought to be liver-specific, this protein has been found in other tissues as well. At least one transcribed pseudogene has been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GLS2