We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

GLS2 Antibody [Alexa Fluor® 594]

Images

 

Product Details

Summary
Product Discontinued
View other related GLS2 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-54773AF594
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

GLS2 Antibody [Alexa Fluor® 594] Summary

Immunogen
Synthetic peptides corresponding to GLS2(glutaminase 2 (liver, mitochondrial)) The peptide sequence was selected from the middle region of GLS2. Peptide sequence FVGKEPSGLRYNKLSLNEEGIPHNPMVNAGAIVVSSLIKMDCNKAEKFDF. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GLS2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
Protein A purified

Notes



Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for GLS2 Antibody [Alexa Fluor® 594]

  • EC 3.5.1.2
  • GAbreast cell glutaminase
  • GLSglutaminase GA
  • glutaminase 2 (liver, mitochondrial)
  • glutaminase I
  • glutaminase liver isoform, mitochondrial
  • hLGA
  • LGA
  • L-glutaminase
  • L-glutamine amidohydrolase
  • MGC71567
  • phosphate-activated glutaminase
  • phosphate-dependent glutaminase
  • truncated glutaminase 2

Background

The protein encoded by the GLS2 gene is a mitochondrial phosphate-activated glutaminase that catalyzes the hydrolysis of glutamine to stoichiometric amounts of glutamate and ammonia. This protein is functionally similar to the kidney glutaminase but is a little smaller in size. Originally thought to be liver-specific, this protein has been found in other tissues as well. At least one transcribed pseudogene has been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-94035
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC,  IHC-P, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NB120-2928
Species: Hu, Mu, Pm, Rb, Rt, Sh
Applications: ICC/IF, IHC,  IHC-P, IP, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
DY417
Species: Mu
Applications: ELISA
NBP1-88866
Species: Hu
Applications: IHC,  IHC-P
NB110-41404
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
M6000B
Species: Mu
Applications: ELISA
MAB7616
Species: Hu
Applications: CyTOF-ready, Flow, WB
AF3880
Species: Hu
Applications: ICC, WB
NBP2-67416
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF2009
Species: Hu
Applications: ICC, IHC
NBP2-46518
Species: Hu
Applications: IHC,  IHC-P, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
AF7895
Species: Hu
Applications: IHC, WB
664-LI
Species: Hu
Applications: BA
DVE00
Species: Hu
Applications: ELISA
NBP2-20383
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-54773AF594
Species: Hu
Applications: WB, IHC

Publications for GLS2 Antibody (NBP1-54773AF594) (0)

There are no publications for GLS2 Antibody (NBP1-54773AF594).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GLS2 Antibody (NBP1-54773AF594) (0)

There are no reviews for GLS2 Antibody (NBP1-54773AF594). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GLS2 Antibody (NBP1-54773AF594) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GLS2 Products

Array NBP1-54773AF594

Research Areas for GLS2 Antibody (NBP1-54773AF594)

Find related products by research area.

Blogs on GLS2

There are no specific blogs for GLS2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GLS2 Antibody [Alexa Fluor® 594] and receive a gift card or discount.

Bioinformatics

Gene Symbol GLS2