GLRB Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit GLRB Antibody - BSA Free (NBP3-04875) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 23-265 of human GLRB (NP_000815.1). KEKSSKKGKGKKKQYLCPSQQSAEDLARVPANSTSNILNRLLVSYDPRIRPNFKGIPVDVVVNIFINSFGSIQETTMDYRVNIFLRQKWNDPRLKLPSDFRGSDALTVDPTMYKCLWKPDLFFANEKSANFHDVTQENILLFIFRDGDVLVSMRLSITLSCPLDLTLFPMDTQRCKMQLESFGYTTDDLRFIWQSGDPVQLEKIALPQFDIKKEDIEYGNCTKYYKGTGYYTCVEVIFTLRRQ |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
GLRB |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Western Blot 1:1000-1:2000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for GLRB Antibody - BSA Free
Background
GLRB, also known as Glycine receptor subunit beta, has a 497 amino acid long isoform that is 56 kDa and a short 303 amino acid isoform that is 35 kDa, composed of alpha and beta subunits, responsible for mediating the inhibitory effects of glycine functioning as a neurotransmitter-gated ion channel which produces hyperpolarization via increased chloride conductance due to the binding of glycine to the receptor. Current research is being performed on several diseases and disorders including hyperekplexia, stiff-person syndrome, neurological disorder, autosomal recessive, startle disease, idiopathic generalized epilepsy, spasticity, pharyngitis, neuronitis, and lung cancer. This protein has also been shown to have interactions with GPHN and PFN1 in pathways such as neurophysiological process PGE2-induced pain processing, ligand-gated ion channel transport, transmembrane transport of small molecules, ion channel transport, and neuroactive ligand-receptor interaction.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IP, WB
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Mu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ChIP, IHC, IHC-P, WB
Species: Ha, Hu, Rt
Applications: IHC, IHC-P, IP, PEP-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Publications for GLRB Antibody (NBP3-04875) (0)
There are no publications for GLRB Antibody (NBP3-04875).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GLRB Antibody (NBP3-04875) (0)
There are no reviews for GLRB Antibody (NBP3-04875).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for GLRB Antibody (NBP3-04875) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional GLRB Products
Research Areas for GLRB Antibody (NBP3-04875)
Find related products by research area.
|
Blogs on GLRB