GLOD4 Antibody

Images

 
Western Blot: GLOD4 Antibody [NBP1-88464] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunocytochemistry/ Immunofluorescence: GLOD4 Antibody [NBP1-88464] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus, nucleoli & cytosol.
Immunohistochemistry-Paraffin: GLOD4 Antibody [NBP1-88464] - Staining of human stomach shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GLOD4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ELTYNYGVGDYKLGNDFMGITLASSQAVSNARKLEWPLTEVAEGVFETEAPGGYKFYLQNRSLPQSDPVLKV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GLOD4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GLOD4 Protein (NBP1-88464PEP)

Reactivity Notes

Rat (89%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GLOD4 Antibody

  • C17orf25
  • CGI-150
  • chromosome 17 open reading frame 25
  • glyoxalase domain containing 4
  • glyoxalase domain-containing protein 4
  • HC71

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84412
Species: Hu
Applications: IHC, IHC-P
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
NBP2-01072
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-85594
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP2-37262
Species: Hu, Rt
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
NBP2-59312
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-19015
Species: Hu, Mu
Applications: WB, Simple Western, ELISA, ICC/IF, IP
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56630
Species: Hu
Applications: WB
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NB110-40591
Species: Hu
Applications: WB, IHC-P, IP
H00001406-M02
Species: Hu, Mu
Applications: WB, ChIP, ELISA, ICC/IF
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87142
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84570
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2385
Species: Hu, Po, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP2-14510
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for GLOD4 Antibody (NBP1-88464) (0)

There are no publications for GLOD4 Antibody (NBP1-88464).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GLOD4 Antibody (NBP1-88464) (0)

There are no reviews for GLOD4 Antibody (NBP1-88464). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GLOD4 Antibody (NBP1-88464) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GLOD4 Products

Bioinformatics Tool for GLOD4 Antibody (NBP1-88464)

Discover related pathways, diseases and genes to GLOD4 Antibody (NBP1-88464). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GLOD4 Antibody (NBP1-88464)

Discover more about diseases related to GLOD4 Antibody (NBP1-88464).
 

Pathways for GLOD4 Antibody (NBP1-88464)

View related products by pathway.

Blogs on GLOD4

There are no specific blogs for GLOD4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GLOD4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GLOD4