GLIPR1L1 Antibody

Images

 
Western Blot: GLIPR1L1 Antibody [H00256710-B03P] - Analysis of GLIPR1L1 expression in transfected 293T cell line. Lane 1: MGC26856 transfected lysate (25.63 KDa). Lane 2: Non-transfected lysate.
Flow Cytometry: GLIPR1L1 Antibody [H00256710-B03P] - Analysis of negative control 293 cells (Black) and GLIPR1L1 expressing 293 cells (Green) using GLIPR1L1 purified mouse polyclonal antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, Flow
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

GLIPR1L1 Antibody Summary

Immunogen
GLIPR1L1 (NP_689992.1, 1 a.a. - 233 a.a.) full-length human protein. MALKNKFSCLWILGLCLVATTSSKIPSITDPHFIDNCIEAHNEWRGKVNPPAADMKYMIWDKGLAKMAKAWANQCKFEHNDCLDKSYKCYAAFEYVGENIWLGGIKSFTPRHAITAWYNETQFYDFDSLSCSRVCGHYTQLVWANSFYVGCAVAMCPNLGGASTAIFVCNYGPAGNFANMPPYVRGESCSLCSKEEKCVKNLCKNPFLKPTGRAPQQTAFNPFSLGFLLLRIF
Specificity
Reacts with GLI pathogenesis-related 1 like 1.
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
GLIPR1L1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • Flow Cytometry
Application Notes
This antibody is reactive against transfected lysate in western blot, FACS analysis, and as a detection antibody in ELISA. It is also useful in FACS analysis.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GLIPR1L1 Antibody

  • ALKN2972
  • GLI pathogenesis-related 1 like 1
  • GLIPR1-like protein 1
  • MGC26856
  • PRO7434

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4468
Species: Mu
Applications: WB
NBP2-82092
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
AF6386
Species: Hu
Applications: WB, IP
NBL1-14964
Species: Hu
NBP2-24653
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-86644
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF3690
Species: Hu, Mu
Applications: WB, ChIP, ICC
NBP1-86641
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-01650
Species: Hu, Mu, Pm
Applications: WB, Flow, IHC, IHC-P
NBP1-71662
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-83792
Species: Hu
Applications: IHC, IHC-P
NBP2-76393
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CHIP-SEQ
H00256710-B03P
Species: Hu
Applications: WB, Flow

Publications for GLIPR1L1 Antibody (H00256710-B03P) (0)

There are no publications for GLIPR1L1 Antibody (H00256710-B03P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GLIPR1L1 Antibody (H00256710-B03P) (0)

There are no reviews for GLIPR1L1 Antibody (H00256710-B03P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GLIPR1L1 Antibody (H00256710-B03P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional GLIPR1L1 Products

Bioinformatics Tool for GLIPR1L1 Antibody (H00256710-B03P)

Discover related pathways, diseases and genes to GLIPR1L1 Antibody (H00256710-B03P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GLIPR1L1 Antibody (H00256710-B03P)

Discover more about diseases related to GLIPR1L1 Antibody (H00256710-B03P).
 

Pathways for GLIPR1L1 Antibody (H00256710-B03P)

View related products by pathway.

PTMs for GLIPR1L1 Antibody (H00256710-B03P)

Learn more about PTMs related to GLIPR1L1 Antibody (H00256710-B03P).
 

Research Areas for GLIPR1L1 Antibody (H00256710-B03P)

Find related products by research area.

Blogs on GLIPR1L1

There are no specific blogs for GLIPR1L1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GLIPR1L1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GLIPR1L1
Entrez
Uniprot