Novus Biologicals products are now on bio-techne.com

GLIPR1L1 Antibody

Images

 
Western Blot: GLIPR1L1 Antibody [H00256710-B03P] - Analysis of GLIPR1L1 expression in transfected 293T cell line. Lane 1: MGC26856 transfected lysate (25.63 KDa). Lane 2: Non-transfected lysate.
Flow Cytometry: GLIPR1L1 Antibody [H00256710-B03P] - Analysis of negative control 293 cells (Black) and GLIPR1L1 expressing 293 cells (Green) using GLIPR1L1 purified mouse polyclonal antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, Flow
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

GLIPR1L1 Antibody Summary

Immunogen
GLIPR1L1 (NP_689992.1, 1 a.a. - 233 a.a.) full-length human protein. MALKNKFSCLWILGLCLVATTSSKIPSITDPHFIDNCIEAHNEWRGKVNPPAADMKYMIWDKGLAKMAKAWANQCKFEHNDCLDKSYKCYAAFEYVGENIWLGGIKSFTPRHAITAWYNETQFYDFDSLSCSRVCGHYTQLVWANSFYVGCAVAMCPNLGGASTAIFVCNYGPAGNFANMPPYVRGESCSLCSKEEKCVKNLCKNPFLKPTGRAPQQTAFNPFSLGFLLLRIF
Specificity
Reacts with GLI pathogenesis-related 1 like 1.
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
GLIPR1L1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Flow Cytometry
  • Western Blot 1:500
Application Notes
This antibody is reactive against transfected lysate in western blot, FACS analysis, and as a detection antibody in ELISA. It is also useful in FACS analysis.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GLIPR1L1 Antibody

  • ALKN2972
  • GLI pathogenesis-related 1 like 1
  • GLIPR1-like protein 1
  • MGC26856
  • PRO7434

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4468
Species: Mu
Applications: WB
NBP2-82092
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-02541
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF6386
Species: Hu
Applications: IP, WB
NBL1-14964
Species: Hu
Applications: WB
NBP2-24653
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-86644
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF3690
Species: Hu, Mu
Applications: ChIP, ICC, WB
NBP1-86641
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-01650
Species: Hu, Pm, Mu
Applications: Flow, IHC, IHC-P, WB
MAB41051
Species: Hu, Mu
Applications: IHC, WB
NBP1-83792
Species: Hu
Applications: IHC, IHC-P
NBP2-76393
Species: Hu, Mu
Applications: CHIP-SEQ, Flow, ICC/IF, IHC, IHC-P, IP, WB
H00256710-B03P
Species: Hu
Applications: WB, Flow

Publications for GLIPR1L1 Antibody (H00256710-B03P) (0)

There are no publications for GLIPR1L1 Antibody (H00256710-B03P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GLIPR1L1 Antibody (H00256710-B03P) (0)

There are no reviews for GLIPR1L1 Antibody (H00256710-B03P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GLIPR1L1 Antibody (H00256710-B03P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GLIPR1L1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GLIPR1L1
Entrez
Uniprot