GLI-1 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GLI-1. Source: E. coli Amino Acid Sequence: PPENGASSLPGLMPAQHYLLRARYASARGGGTSPTAASSLDRIGGLPMPPWRSRAEYPGYNPNAGVTRRASDPAQAADRPAPARVQRFKS Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
GLI1 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56230. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
27 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for GLI-1 Recombinant Protein Antigen
Background
Gli1 was produced against a peptide corresponding to the carboxy-terminal region of the mouse Gli-1 protein. This region is not conserved among other gli family members, namely Gli-2 and Gli-3. Gli was termed by Kinzler et al. (1987) as 'glioma-associated oncogene' amplified in malignant gliomas. Analysis of the cloned gene demonstrates that the gene contains 5 repeats of zinc-finger sequences, which places gli in the family of Kruppel (Kr) zinc finger proteins. Northern analysis reveals that GLI is expressed in embryonal carcinoma cells but not in most adult tissue. GLI has been localized to 12q13-q14.3 by Southern blot analysis. On mouse the gene is located on chromosome 10. In mice, 3 zinc finger transcription factors, Gli-1, Gl-i2 and Gli-3, have been implicated in the transduction of Sonic hedgehog (Shh) signal. In papillary epithelium, shh, gli1 and ptc all follow similar expression patterns. Gli1 expression is central and probably sufficient for tumor development in humans.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: BA
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu
Applications: WB
Species: Mu
Applications: IHC, WB
Species: Bt, Bv, Ca, Eq, Ha, Hu, Pm, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ChIP, ICC, WB
Species: Mu
Applications: IHC, WB
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Publications for GLI-1 Recombinant Protein Antigen (NBP2-56230PEP) (0)
There are no publications for GLI-1 Recombinant Protein Antigen (NBP2-56230PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GLI-1 Recombinant Protein Antigen (NBP2-56230PEP) (0)
There are no reviews for GLI-1 Recombinant Protein Antigen (NBP2-56230PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for GLI-1 Recombinant Protein Antigen (NBP2-56230PEP) (0)
Additional GLI-1 Products
Research Areas for GLI-1 Recombinant Protein Antigen (NBP2-56230PEP)
Find related products by research area.
|
Blogs on GLI-1