GLDC Antibody

Images

 
Orthogonal Strategies: Western Blot: GLDC Antibody [NBP2-38682] - Analysis in human cell lines Caco-2 and HeLa using anti-GLDC antibody. Corresponding GLDC RNA-seq data are presented for the same cell lines. ...read more
Immunocytochemistry/ Immunofluorescence: GLDC Antibody [NBP2-38682] - Immunofluorescent staining of human cell line Hep G2 shows localization to nucleus & mitochondria.
Orthogonal Strategies: Immunohistochemistry-Paraffin: GLDC Antibody [NBP2-38682] - Staining in human kidney and pancreas tissues using anti-GLDC antibody. Corresponding GLDC RNA-seq data are presented for the ...read more
Western Blot: GLDC Antibody [NBP2-38682] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue
Immunohistochemistry-Paraffin: GLDC Antibody [NBP2-38682] - Staining of human kidney shows high expression.
Immunohistochemistry-Paraffin: GLDC Antibody [NBP2-38682] - Staining of human pancreas shows low expression as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

GLDC Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: SCTMKLNSSSELAPITWKEFANIHPFVPLDQAQGYQQLFRELEKDLCELTGYDQVCFQPNSGAQGEYAGLATIRAYLNQKGEGHRTVCLIPKSAHGTNPASAHMAGMKIQPVEVDKYGNIDAVHLKAMVDKHKENL
Specificity
Specificity of human GLDC antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GLDC
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GLDC Protein (NBP2-38682PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GLDC Antibody

  • EC 1.4.4.2
  • GCE
  • GCSPMGC138198
  • Glycine cleavage system P protein
  • glycine cleavage system protein P
  • glycine decarboxylase P-protein
  • Glycine decarboxylase
  • glycine dehydrogenase (decarboxylating)
  • glycine dehydrogenase (decarboxylating; glycine decarboxylase, glycine cleavagesystem protein P)
  • glycine dehydrogenase [decarboxylating], mitochondrial
  • HYGN1
  • MGC138200
  • NKH

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00004608-M01
Species: Hu
Applications: WB, ELISA
NBP1-89783
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85842
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
366-6C/CF
Species: Hu
NBP2-32173
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80754
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67599
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-15304
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF
MAB1106
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP1-91933
Species: Hu
Applications: WB, IHC, IHC-P
MAB1936
Species: Hu
Applications: WB, IP
MAB1368
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-60052
Species: Hu
Applications: WB
NBP2-38682
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for GLDC Antibody (NBP2-38682) (0)

There are no publications for GLDC Antibody (NBP2-38682).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GLDC Antibody (NBP2-38682) (0)

There are no reviews for GLDC Antibody (NBP2-38682). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GLDC Antibody (NBP2-38682) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for GLDC Antibody (NBP2-38682)

Discover related pathways, diseases and genes to GLDC Antibody (NBP2-38682). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GLDC Antibody (NBP2-38682)

Discover more about diseases related to GLDC Antibody (NBP2-38682).
 

Pathways for GLDC Antibody (NBP2-38682)

View related products by pathway.

PTMs for GLDC Antibody (NBP2-38682)

Learn more about PTMs related to GLDC Antibody (NBP2-38682).
 

Research Areas for GLDC Antibody (NBP2-38682)

Find related products by research area.

Blogs on GLDC

There are no specific blogs for GLDC, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GLDC Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GLDC
Uniprot