GID4 Antibody Summary
Immunogen |
Synthetic peptides corresponding to C17ORF39 The peptide sequence was selected from the C terminal of C17ORF39.
Peptide sequence SFAGFYYICFQKSAASIEGYYYHRSSEWYQSLNLTHVPEHSAPIYEFR. The peptide sequence for this immunogen was taken from within the described region. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
GID4 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Application Notes |
This is a rabbit polyclonal antibody against C17orf39 and was validated on Western blot. |
Theoretical MW |
33 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS and 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Purity |
Immunogen affinity purified |
Notes
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Alternate Names for GID4 Antibody
Background
The exact function of C17orf39 remains unknown. The multiprotein Mediator complex is a coactivator required for activation of RNA polymerase II transcription by DNA bound transcription factors. The protein encoded by this gene is thought to be a subunit of the Mediator complex. This gene is located within the Smith-Magenis syndrome region on chromosome 17.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Am, Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, IP, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, KO, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu
Applications: WB
Publications for GID4 Antibody (NBP1-53185) (0)
There are no publications for GID4 Antibody (NBP1-53185).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GID4 Antibody (NBP1-53185) (0)
There are no reviews for GID4 Antibody (NBP1-53185).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for GID4 Antibody (NBP1-53185) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional GID4 Products
Bioinformatics Tool for GID4 Antibody (NBP1-53185)
Discover related pathways, diseases and genes to GID4 Antibody (NBP1-53185). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for GID4 Antibody (NBP1-53185)
Discover more about diseases related to GID4 Antibody (NBP1-53185).
| | Pathways for GID4 Antibody (NBP1-53185)
View related products by pathway.
|
PTMs for GID4 Antibody (NBP1-53185)
Learn more about PTMs related to GID4 Antibody (NBP1-53185).
|
Blogs on GID4