GGPS1 Antibody - BSA Free

Western Blot: GGPS1 Antibody [NBP3-35656] - Western blot analysis of lysates from 293T cells, using GGPS1 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 3s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GGPS1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GGPS1 Antibody - BSA Free (NBP3-35656) is a polyclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 164-300 of human GGPS1 (NP_001032354.1).
  
  Sequence:
  QLFSDYKEDLKPLLNTLGLFFQIRDDYANLHSKEYSENKSFCEDLTEGKFSFPTIHAIWSRPESTQVQNILRQRTENIDIKKYCVHYLEDVGSFEYTRNTLKELEAKAYKQIDARGGNPELVALVKHLSKMFKEENE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GGPS1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 35 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for GGPS1 Antibody - BSA Free

• 6E)-farnesyl diphosphate synthase
• dimethylallyltranstransferase
• EC 2.5.1.1
• EC 2.5.1.10
• EC 2.5.1.29
• Farnesyl diphosphate synthase
• Farnesyltranstransferase
• geranylgeranyl diphosphate synthase 1
• Geranylgeranyl diphosphate synthase
• geranylgeranyl pyrophosphate synthase
• geranyltranstransferase
• GGPP synthase
• GGPPS
• GGPPS1farnesyltranstransferase
• GGPPSase

Background

GGPS1 is a member of the prenyltransferase family and encodes a protein with geranylgeranyl diphosphate (GGPP) synthase activity. The enzyme catalyzes the synthesis of GGPP from farnesyl diphosphate and isopentenyl diphosphate. GGPP is an important molecule responsible for the C20-prenylation of proteins and for the regulation of a nuclear hormone receptor. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GGPS1