GGPS1 Antibody - BSA Free

Western Blot: GGPS1 Antibody [NBP1-53050] - 293T cells lysate, concentration 0.2-1 ug/ml.

Immunohistochemistry-Paraffin: GGPS1 Antibody [NBP1-53050] - Formalin Fixed Paraffin; Embedded Tissue: Human Pineal Tissue; Observed Staining: Cytoplasmic in endothelial cells in blood vessels; Primary Antibody Concentration: 1:100

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

GGPS1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to GGPS1(geranylgeranyl diphosphate synthase 1) The peptide sequence was selected from the middle region of GGPS1 (NP_001032354). Peptide sequence LGLFFQIRDDYANLHSKEYSENKSFCEDLTEGKFSFPTIHAIWSRPESTQ. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GGPS1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml
• Theoretical MW: 35 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for GGPS1 Antibody - BSA Free

• 6E)-farnesyl diphosphate synthase
• dimethylallyltranstransferase
• EC 2.5.1.1
• EC 2.5.1.10
• EC 2.5.1.29
• Farnesyl diphosphate synthase
• Farnesyltranstransferase
• geranylgeranyl diphosphate synthase 1
• Geranylgeranyl diphosphate synthase
• geranylgeranyl pyrophosphate synthase
• geranyltranstransferase
• GGPP synthase
• GGPPS
• GGPPS1farnesyltranstransferase
• GGPPSase

Background

GGPS1 is a member of the prenyltransferase family and has geranylgeranyl diphosphate (GGPP) synthase activity. The enzyme catalyzes the synthesis of GGPP from farnesyl diphosphate and isopentenyl diphosphate. GGPP is an important molecule responsible for the C20-prenylation of proteins and for the regulation of a nuclear hormone receptor. The protein is an important precursor of carotenoids and geranylated proteins. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.This gene is a member of the prenyltransferase family and encodes a protein with geranylgeranyl diphosphate (GGPP) synthase activity. The enzyme catalyzes the synthesis of GGPP from farnesyl diphosphate and isopentenyl diphosphate. GGPP is an important molecule responsible for the C20-prenylation of proteins and for the regulation of a nuclear hormone receptor. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GGPS1
• Entrez:
  • 9453(Human)
• Uniprot:
  • O95749(Human)