GFM1 Antibody


Western Blot: GFM1 Antibody [NBP1-98458] - Mouse Heart Lysate 1.0ug/ml, Gel Concentration: 12%

Product Details

Reactivity MuSpecies Glossary
Applications WB

Order Details

GFM1 Antibody Summary

The immunogen for this antibody is Gfm1 - C-terminal region. Peptide sequence ELRSCTEGKGEYTMEYCRYQPCSPSTQEELINKYLEATGQLPVKKGKAKN.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:1000

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for GFM1 Antibody

  • EFG
  • EFG1FLJ12662
  • EFGM
  • EF-Gmt
  • EGF1
  • FLJ13632
  • FLJ20773
  • G elongation factor, mitochondrial 1
  • G translation elongation factor, mitochondrial
  • hEFG1
  • mEF-G 1
  • mitochondrial elongation factor G
  • mitochondrial elongation factor G1
  • mitochondrial


Gfm1 is a mitochondrial GTPase that catalyzes the GTP-dependent ribosomal translocation step during translation elongation. During this step, the ribosome changes from the pre-translocational (PRE) to the post-translocational (POST) state as the newly formed A-site-bound peptidyl-tRNA and P-site-bound deacylated tRNA move to the P and E sites, respectively. Gfm1 catalyzes the coordinated movement of the two tRNA molecules, the mRNA and conformational changes in the ribosome. Gfm1 does not mediate the disassembly of ribosomes from messenger RNA at the termination of mitochondrial protein biosynthesis.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for GFM1 Antibody (NBP1-98458) (0)

There are no publications for GFM1 Antibody (NBP1-98458).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GFM1 Antibody (NBP1-98458) (0)

There are no reviews for GFM1 Antibody (NBP1-98458). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GFM1 Antibody (NBP1-98458) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional GFM1 Products

Bioinformatics Tool for GFM1 Antibody (NBP1-98458)

Discover related pathways, diseases and genes to GFM1 Antibody (NBP1-98458). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GFM1 Antibody (NBP1-98458)

Discover more about diseases related to GFM1 Antibody (NBP1-98458).

Pathways for GFM1 Antibody (NBP1-98458)

View related products by pathway.

Blogs on GFM1

There are no specific blogs for GFM1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our GFM1 Antibody and receive a gift card or discount.


Gene Symbol GFM1