Recombinant Human GFI-1 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human GFI-1 Protein [H00002672-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human GFI-1 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-91 of Human GFI-1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MPRSFLVKSKKAHSYHQPRSPGPDYSLRLENVPAPSRADSTSNAGGAKAEPRDRLSPESQLTEAPDRASASPRQLRSSVCERSSEFEDFWR

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
GFI1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
35.75 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GFI-1 GST (N-Term) Protein

  • GFI1
  • GFI-1
  • growth factor independence-1
  • growth factor independent 1 transcription repressor
  • growth factor independent 1
  • Growth factor independent protein 1
  • Pal-1
  • SCN2
  • Zinc finger protein 163
  • zinc finger protein Gfi-1
  • ZNF163
  • ZNF163FLJ94509

Background

GFI1 - growth factor independent 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB9167
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
202-IL
Species: Hu
Applications: BA
NBP2-84040
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-27163
Species: Bv, Ca, Eq, Hu, Mu, Pm
Applications: Flow, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-55747
Species: Hu
Applications: ICC/IF, WB
NBP2-31366
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
NB300-996
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
207-IL/CF
Species: Hu
Applications: BA
210-TA
Species: Hu
Applications: BA
6507-IL/CF
Species: Hu
Applications: BA
NBP1-31647
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
AF2168
Species: Hu, Mu
Applications: ChIP, Simple Western, WB
AF1584
Species: Hu, Mu
Applications: CyTOF-ready, ICC, IP, ICFlow, KO, Simple Western, WB

Publications for GFI-1 Partial Recombinant Protein (H00002672-Q01) (0)

There are no publications for GFI-1 Partial Recombinant Protein (H00002672-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GFI-1 Partial Recombinant Protein (H00002672-Q01) (0)

There are no reviews for GFI-1 Partial Recombinant Protein (H00002672-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GFI-1 Partial Recombinant Protein (H00002672-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GFI-1 Products

Bioinformatics Tool for GFI-1 Partial Recombinant Protein (H00002672-Q01)

Discover related pathways, diseases and genes to GFI-1 Partial Recombinant Protein (H00002672-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GFI-1 Partial Recombinant Protein (H00002672-Q01)

Discover more about diseases related to GFI-1 Partial Recombinant Protein (H00002672-Q01).
 

Pathways for GFI-1 Partial Recombinant Protein (H00002672-Q01)

View related products by pathway.

PTMs for GFI-1 Partial Recombinant Protein (H00002672-Q01)

Learn more about PTMs related to GFI-1 Partial Recombinant Protein (H00002672-Q01).
 

Research Areas for GFI-1 Partial Recombinant Protein (H00002672-Q01)

Find related products by research area.

Blogs on GFI-1

There are no specific blogs for GFI-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GFI-1 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GFI1