Gephyrin/GPHN Antibody

Images

 
Western Blot: Gephyrin/GPHN Antibody [NBP1-87875] - Lane 1: Marker [kDa] 230, 110, 82, 49, 32, 26, 18. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more
Immunohistochemistry-Paraffin: Gephyrin/GPHN Antibody [NBP1-87875] - Staining of human lateral ventricle shows moderate cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Gephyrin/GPHN Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ATIQEHGYPTINLGIVGDNPDDLLNALNEGISRADVIITSGGVSMGEKDYLKQVLDIDLHAQIHFGRVFMKPGLPTTFATLDIDGVRKIIFALPGNPVSAVVTCNLFVVPALRKMQGILDPRPTIIKARLSCDVKLDPRPEY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GPHN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Gephyrin/GPHN Protein (NBP1-87875PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Gephyrin/GPHN Antibody

  • GEPH
  • Gephyrin
  • GPH
  • GPHN
  • GPHRYN
  • KIAA1385GPHGEPH

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB7848
Species: Hu
Applications: WB, IHC
NBP2-46628
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
NBP2-45808
Species: Hu
Applications: IHC
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
AF2086
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-41299
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-33284
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-653
Species: Hu, Mu, Rt, Ch, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-71771
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30683
Species: Hu
Applications: IHC, IHC-P
NBP1-81045
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-113
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr
NB300-556
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-92130
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NBP1-32423
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-50048
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF
NBP1-87875
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Gephyrin/GPHN Antibody (NBP1-87875) (0)

There are no publications for Gephyrin/GPHN Antibody (NBP1-87875).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Gephyrin/GPHN Antibody (NBP1-87875) (0)

There are no reviews for Gephyrin/GPHN Antibody (NBP1-87875). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Gephyrin/GPHN Antibody (NBP1-87875) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Gephyrin/GPHN Products

Bioinformatics Tool for Gephyrin/GPHN Antibody (NBP1-87875)

Discover related pathways, diseases and genes to Gephyrin/GPHN Antibody (NBP1-87875). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Gephyrin/GPHN Antibody (NBP1-87875)

Discover more about diseases related to Gephyrin/GPHN Antibody (NBP1-87875).
 

Pathways for Gephyrin/GPHN Antibody (NBP1-87875)

View related products by pathway.

Blogs on Gephyrin/GPHN

There are no specific blogs for Gephyrin/GPHN, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Gephyrin/GPHN Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GPHN
Entrez