![Western Blot: Genethonin 1 Antibody [NBP1-91935] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue](http://images.novusbio.com/fullsize/Genethonin-1-Antibody-Western-Blot-NBP1-91935-img0005.jpg "Western Blot: Genethonin 1 Antibody [NBP1-91935] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EHLQESNGHLISKTKDLGKLQAASWRLQNPSREVCDNSREHVPSGQFPDTEAPATSETSNSRSYSEVSRNESLESPMGEWGFQKGQEISAKAATCFAEKLPSSNLLKNRAKEEMSLSDLNSQDRV |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | STBD1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | STBD1 |
![Immunohistochemistry-Paraffin: Genethonin 1 Antibody [NBP1-91935] - Staining of human testis.](http://images.novusbio.com/fullsize/Genethonin-1-Antibody-Immunohistochemistry-Paraffin-NBP1-91935-img0011.jpg "Immunohistochemistry-Paraffin: Genethonin 1 Antibody [NBP1-91935] - Staining of human testis.")
![Immunohistochemistry-Paraffin: Genethonin 1 Antibody [NBP1-91935] - Staining of human skeletal muscle shows high expression.](http://images.novusbio.com/fullsize/Genethonin-1-Antibody-Immunohistochemistry-Paraffin-NBP1-91935-img0006.jpg "Immunohistochemistry-Paraffin: Genethonin 1 Antibody [NBP1-91935] - Staining of human skeletal muscle shows high expression.")
![Immunohistochemistry-Paraffin: Genethonin 1 Antibody [NBP1-91935] - Staining of human skin shows low expression as expected.](http://images.novusbio.com/fullsize/Genethonin-1-Antibody-Immunohistochemistry-Paraffin-NBP1-91935-img0007.jpg "Immunohistochemistry-Paraffin: Genethonin 1 Antibody [NBP1-91935] - Staining of human skin shows low expression as expected.")
![Immunohistochemistry-Paraffin: Genethonin 1 Antibody [NBP1-91935] - Staining in human skeletal muscle and skin tissues using anti-STBD1 antibody. Corresponding STBD1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Genethonin-1-Antibody-Immunohistochemistry-Paraffin-NBP1-91935-img0008.jpg "Immunohistochemistry-Paraffin: Genethonin 1 Antibody [NBP1-91935] - Staining in human skeletal muscle and skin tissues using anti-STBD1 antibody. Corresponding STBD1 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: Genethonin 1 Antibody [NBP1-91935] - Staining of human colon, skeletal muscle, skin and testis using Anti-STBD1 antibody NBP1-91935 (A) shows similar protein distribution across tissues to independent antibody NBP1-91936 (B).](http://images.novusbio.com/fullsize/Genethonin-1-Antibody-Immunohistochemistry-Paraffin-NBP1-91935-img0009.jpg "Immunohistochemistry-Paraffin: Genethonin 1 Antibody [NBP1-91935] - Staining of human colon, skeletal muscle, skin and testis using Anti-STBD1 antibody NBP1-91935 (A) shows similar protein distribution across tissues to independent antibody NBP1-91936 (B).")
![Immunohistochemistry-Paraffin: Genethonin 1 Antibody [NBP1-91935] - Staining of human colon.](http://images.novusbio.com/fullsize/Genethonin-1-Antibody-Immunohistochemistry-Paraffin-NBP1-91935-img0010.jpg "Immunohistochemistry-Paraffin: Genethonin 1 Antibody [NBP1-91935] - Staining of human colon.")
![Bioactivity FGF-20 [Unconjugated]](https://images.novusbio.com/images/protein/2547-fgcf_recombinant-human-fgf-20-protein-cf-bioactivity-181120209345.jpg)
![Western Blot Osteoactivin/GPNMB Antibody [Unconjugated]](https://images.novusbio.com/images2/Osteoactivin_AF2550_Western_Blot_19926.jpg)
![Immunohistochemistry Osteoactivin/GPNMB Antibody [Unconjugated]](https://images.novusbio.com/images2/Osteoactivin_AF2550_Immunohistochemistry_15337.jpg)
![Knockdown Validated Osteoactivin/GPNMB Antibody [Unconjugated]](https://images.novusbio.com/images/af2550_human-osteoactivin-gpnmb-affinity-purified-polyclonal-ab-61220241239347.png)
![Western Blot Syntaxin 1B Antibody (676204) [Unconjugated]](https://images.novusbio.com/images2/Syntaxin_1B_MAB6848_Western_Blot_10976.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")