Recombinant Human Gemin 7 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Gemin 7 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-131 of Human GEMIN7 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MQTPVNIPVPVLRLPRGPDGFSRGFAPDGRRAPLRPEVPEIQECPIAQESLESQEQRARAALRERYLRSLLAMVGHQVSFTLHEGVRVAAHFGATDLDVANFYVSQLQTPIGVQAEALLRCSDIISYTFKP

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
GEMIN7
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Gemin 7 Protein

  • FLJ13956
  • gem (nuclear organelle) associated protein 7
  • gem-associated protein 7
  • gemin 7
  • gemin-7
  • SIP3

Background

GEMIN7( AAH07793, 1 a.a. - 132 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24740
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, IHC-P
NBP1-82075
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1936
Species: Hu, Mu, Rt, Pm, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00006607-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-76798
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-20439
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-77177
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, ICC, IF
NB100-2450
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-88518
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-52453
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC, IF
NBP1-82991
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-61049
Species: Hu, Po, SyHa
Applications: WB, IP
NBP1-76636
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB110-40591
Species: Hu
Applications: WB, IHC-P, IP
NB100-55266
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-83925
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-501
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Fi, GP, Ha, Le, Ma, Pm, Rb, Sh, Sq, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-43792
Species: Hu
Applications: WB
NBP1-85341
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Gemin 7 Recombinant Protein (H00079760-P01) (0)

There are no publications for Gemin 7 Recombinant Protein (H00079760-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Gemin 7 Recombinant Protein (H00079760-P01) (0)

There are no reviews for Gemin 7 Recombinant Protein (H00079760-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Gemin 7 Recombinant Protein (H00079760-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Gemin 7 Products

Bioinformatics Tool for Gemin 7 Recombinant Protein (H00079760-P01)

Discover related pathways, diseases and genes to Gemin 7 Recombinant Protein (H00079760-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Gemin 7 Recombinant Protein (H00079760-P01)

Discover more about diseases related to Gemin 7 Recombinant Protein (H00079760-P01).
 

Pathways for Gemin 7 Recombinant Protein (H00079760-P01)

View related products by pathway.

PTMs for Gemin 7 Recombinant Protein (H00079760-P01)

Learn more about PTMs related to Gemin 7 Recombinant Protein (H00079760-P01).

Blogs on Gemin 7

There are no specific blogs for Gemin 7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Gemin 7 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GEMIN7