GEFT Antibody


Immunohistochemistry-Paraffin: GEFT Antibody [NBP2-14309] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

GEFT Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: HSKHCLSVETEADSGQAGPYENWMLEPALATGEELPELTLLTTLLEGPGD KTQPPEEETLSQAPESEEEQKKKALERSMYV
Specificity of human GEFT antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GEFT Protein (NBP2-14309PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (83%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for GEFT Antibody

  • GEFTRAC/CDC42 exchange factor
  • Guanine nucleotide exchange factor GEFT
  • p63RhoGEFrho guanine nucleotide exchange factor 25
  • Rac/Cdc42/Rho exchange factor GEFT
  • Rho guanine nucleotide exchange factor (GEF) 25
  • RhoA/RAC/CDC42 exchange factor
  • RhoA/Rac/Cdc42 guanine nucleotide exchange factor GEFT


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: Flow, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Rt, Bv, Pm
Applications: WB, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
Species: Hu
Applications: IHC, IHC-P

Publications for GEFT Antibody (NBP2-14309) (0)

There are no publications for GEFT Antibody (NBP2-14309).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GEFT Antibody (NBP2-14309) (0)

There are no reviews for GEFT Antibody (NBP2-14309). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for GEFT Antibody (NBP2-14309) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional GEFT Products

Bioinformatics Tool for GEFT Antibody (NBP2-14309)

Discover related pathways, diseases and genes to GEFT Antibody (NBP2-14309). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on GEFT

There are no specific blogs for GEFT, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our GEFT Antibody and receive a gift card or discount.


Gene Symbol ARHGEF25