GCH1 Antibody - BSA Free

Western Blot: GCH1 Antibody [NBP1-79771] - COLO205 cells lysate, concentration 0.2-1 ug/ml.

Product Discontinued

GCH1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide directed towards the C terminal of human GCH1The immunogen for this antibody is GCH1. Peptide sequence LRPAGVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREEFLT. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GCH1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 28 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for GCH1 Antibody - BSA Free

• dystonia 14
• DYT14
• DYT5
• DYT5a
• DYT5EC 3.5.4.16
• GCH
• GCH1
• GTP cyclohydrolase 1
• GTP cyclohydrolase I
• GTPCH1
• GTP-CH-1
• GTP-CH-I
• guanosine 5'-triphosphate cyclohydrolase I
• HPABH4B

Background

GCH1 encodes a member of the GTP cyclohydrolase family. The encoded protein is the first and rate-limiting enzyme in tetrahydrobiopterin (BH4) biosynthesis, catalyzing the conversion of GTP into 7,8-dihydroneopterin triphosphate. BH4 is an essential cofactor required by aromatic amino acid hydroxylases as well as nitric oxide synthases. Mutations in this gene are associated with malignant hyperphenylalaninemia and dopa-responsive dystonia. Several alternatively spliced transcript variants encoding different isoforms have been described; however, not all variants give rise to a functional enzyme.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GCH1 Antibody (NBP1-79771)(1)

Publication using NBP1-79771

• Li H, Nguyen H, Meda Venkata SP et al. Novel Role of GPR35 (G-Protein-Coupled Receptor 35) in the Regulation of Endothelial Cell Function and Blood Pressure Hypertension 2021-09-01 [PMID: 34275335] (Western Blot)

Bioinformatics

• Gene Symbol: GCH1
• Uniprot:
  • NP_000152()