GCH1 Antibody

Images

 
Western Blot: GCH1 Antibody [H00002643-B01P] - Analysis of GCH1 expression in transfected 293T cell line by GCH1 polyclonal antibody. Lane 1: GCH1 transfected lysate(27.5 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/ Immunofluorescence: GCH1 Antibody [H00002643-B01P] - Analysis of purified antibody to GCH1 on HeLa cell. (antibody concentration 10 ug/ml)

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

GCH1 Antibody Summary

Immunogen
GCH1 (NP_000152.1, 1 a.a. - 250 a.a.) full-length human protein. MEKGPVRAPAEKPRGARCSNGFPERDPPRPGPSRPAEKPPRPEAKSAQPADGWKGERPRSEEDNELNLPNLAAAYSSILSSLGENPQRQGLLKTPWRAASAMQFFTKGYQETISDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPFVGKVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQERLTKQIAVAITEALRPAGVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREEFLTLIRS
Specificity
GCH1 - GTP cyclohydrolase 1 (dopa-responsive dystonia),
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
GCH1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. It has been used for IF.
Publications
Read Publication using H00002643-B01P.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GCH1 Antibody

  • dystonia 14
  • DYT14
  • DYT5a
  • DYT5EC 3.5.4.16
  • GCH
  • GTP cyclohydrolase 1
  • GTP cyclohydrolase I
  • GTPCH1
  • GTP-CH-1
  • GTP-CH-I
  • guanosine 5'-triphosphate cyclohydrolase I
  • HPABH4B

Background

This gene encodes a member of the GTP cyclohydrolase family. The encoded protein is the first and rate-limiting enzyme in tetrahydrobiopterin (BH4) biosynthesis, catalyzing the conversion of GTP into 7,8-dihydroneopterin triphosphate. BH4 is an essential cofactor required by aromatic amino acid hydroxylases as well as nitric oxide synthases. Mutations in this gene are associated with malignant hyperphenylalaninemia and dopa-responsive dystonia. Several alternatively spliced transcript variants encoding different isoforms have been described; however, not all variants give rise to a functional enzyme. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
NB100-858
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
NBP2-03256
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-56137
Species: Hu
Applications: ICC/IF
NBP2-47415
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32975
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89366
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
NB110-39113
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-76917
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB300-174
Species: Hu, Mu, Rt, Bv
Applications: WB, Simple Western, IHC, IHC-P
NBP1-88640
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-91931
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59794
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF8038
Species: Hu, Mu, Rt
Applications: WB

Publications for GCH1 Antibody (H00002643-B01P)(1)

Reviews for GCH1 Antibody (H00002643-B01P) (0)

There are no reviews for GCH1 Antibody (H00002643-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GCH1 Antibody (H00002643-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GCH1 Products

Bioinformatics Tool for GCH1 Antibody (H00002643-B01P)

Discover related pathways, diseases and genes to GCH1 Antibody (H00002643-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GCH1 Antibody (H00002643-B01P)

Discover more about diseases related to GCH1 Antibody (H00002643-B01P).
 

Pathways for GCH1 Antibody (H00002643-B01P)

View related products by pathway.

PTMs for GCH1 Antibody (H00002643-B01P)

Learn more about PTMs related to GCH1 Antibody (H00002643-B01P).

Blogs on GCH1

There are no specific blogs for GCH1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GCH1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GCH1
Entrez
Uniprot