GBP3 Antibody - BSA Free

Immunohistochemistry-Paraffin: GBP3 Antibody [NBP1-91929] - Staining of human cerebral cortex shows strong nuclear positivity in glial cells.

Staining of human cerebral cortex shows strong nuclear positivity in glial cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GBP3 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LLEEQEKTLTSKLQEQARVLKERCQGESTQLQNEIQKLQKTLKKKTKRYMSHK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GBP3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  GBP3 Protein (NBP1-91929PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GBP3 Antibody - BSA Free

• DKFZp686E0974
• DKFZp686L15228
• FLJ10961
• GBP-3
• GTP-binding protein 3
• Guanine nucleotide-binding protein 3
• guanylate binding protein 3
• guanylate-binding protein 3

Background

The GBP3 gene codes for a member of the germinal center kinase family that demonstrates antiviral activity against influenza. One isoform is 595 amino acids long at 68 kDa and the other exists at 544 amino acids in length at nearly 62 kDA. The GBP3 gene has been studied in hypoglycemic comas, hepatitis B, and influenza and interacts in pathways of interferon gamma signaling, cytokine signaling in the immune system, and expression of IFNG-stimulated genes. It interacts with genes MAP4K4, NFATC2, and FAM107B.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GBP3