GBF1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: GBF1 Antibody [NBP1-88844] - Immunofluorescent staining of human cell line A-431 shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: GBF1 Antibody [NBP1-88844] - Staining of human heart muscle shows cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GBF1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:INQYSLTVGLDLGPHDTKSLLKCVESLSFIVRDAAHITPDNFELCVKTLRIFVEASLNGGCKSQEKRGKSHKYDSKGNRFK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GBF1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:20-1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GBF1 Protein (NBP1-88844PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GBF1 Antibody

  • ARF1GEF
  • BFA-resistant GEF 1
  • FLJ21263
  • golgi brefeldin A resistant guanine nucleotide exchange factor 1
  • golgi-specific brefeldin A resistance factor 1
  • Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1
  • KIAA0248FLJ21500
  • MGC134877
  • MGC134878

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-505
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
AF6260
Species: Hu
Applications: WB
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-88840
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88607
Species: Hu
Applications: WB, IHC, IHC-P
NB110-41536
Species: Hu, Mu
Applications: WB, ICC/IF
AF3499
Species: Hu
Applications: WB
H00081876-M02
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00056731-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-88527
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-38401
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81804
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-22513
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-92274
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83132
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88844
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for GBF1 Antibody (NBP1-88844) (0)

There are no publications for GBF1 Antibody (NBP1-88844).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GBF1 Antibody (NBP1-88844) (0)

There are no reviews for GBF1 Antibody (NBP1-88844). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for GBF1 Antibody (NBP1-88844) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GBF1 Products

GBF1 NBP1-88844

Bioinformatics Tool for GBF1 Antibody (NBP1-88844)

Discover related pathways, diseases and genes to GBF1 Antibody (NBP1-88844). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GBF1 Antibody (NBP1-88844)

Discover more about diseases related to GBF1 Antibody (NBP1-88844).
 

Pathways for GBF1 Antibody (NBP1-88844)

View related products by pathway.

PTMs for GBF1 Antibody (NBP1-88844)

Learn more about PTMs related to GBF1 Antibody (NBP1-88844).

Blogs on GBF1

There are no specific blogs for GBF1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GBF1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GBF1
Entrez
Uniprot