GBA2 Antibody - BSA Free

Western Blot: GBA2 Antibody [NBP2-84956] - Host: Rabbit. Target Name: GBA2. Sample Tissue: Human 293T Whole Cell lysates. Antibody Dilution: 1ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

GBA2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GBA2 Antibody - BSA Free (NBP2-84956) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GBA2. Peptide sequence: GTVWLEVLEDSLPEELGRNMCHLRPTLRDYGRFGYLEGQEYRMYNTYDVH The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GBA2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for GBA2 Antibody - BSA Free

• AD035
• Beta-glucocerebrosidase 2
• Beta-glucosidase 2
• bile acid beta-glucosidase
• DKFZp762K054
• glucosidase, beta (bile acid) 2
• Glucosylceramidase 2
• KIAA1605EC 3.2.1.45
• MGC16895
• NLGase
• non-lysosomal glucosylceramidase

Background

GBA2 encodes a microsomal beta-glucosidase that catalyzes the hydrolysis of bile acid 3-O-glucosides as endogenous compounds. Studies to determine subcellular localization of this protein in the liver indicated that the enzyme was mainly enriched in the microsomal fraction where it appeared to be confined to the endoplasmic reticulum. This putative transmembrane protein is thought to play a role in carbohydrate transport and metabolism. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GBA2