GATM Antibody - BSA Free

Immunohistochemistry-Paraffin: GATM Antibody [NBP1-89211] - Staining in human kidney and skeletal muscle tissues . Corresponding GATM RNA-seq data are presented for the same tissues.

Western Blot: GATM Antibody [NBP1-89211] - Analysis in human kidney tissue.

Immunocytochemistry/Immunofluorescence: GATM Antibody [NBP1-89211] - Staining of human cell line RH-30 shows localization to mitochondria. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: GATM Antibody [NBP1-89211] - Staining of human duodenum shows moderate to strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: GATM Antibody [NBP1-89211] - Staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: GATM Antibody [NBP1-89211] - Staining of human liver shows moderate to strong cytoplasmic positivity in hepatocytes.

Immunohistochemistry-Paraffin: GATM Antibody [NBP1-89211] - Staining of human skeletal muscle shows no cytoplasmic positivity in myocytes as expected.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

GATM Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit GATM Antibody - BSA Free (NBP1-89211) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LGRTLTGWVQRTFQSTQAATASSRNSCAADDKATEPLPKDCPVSSYNEWDPLEEVIVGRAENACVPPFTIEVKANTYEKYWPFYQKQGGHYFPKDHLKKAVAEIEEMCNILKTEGVTVRRPDPIDWSLKYKTPD
• Predicted Species: Mouse (93%), Rat (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GATM
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  GATM Protein (NBP1-89211PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GATM Antibody - BSA Free

• AGATtransamidinase
• AT
• EC 2.1.4
• EC 2.1.4.1
• glycine amidinotransferase (L-arginine:glycine amidinotransferase)
• glycine amidinotransferase, mitochondrial
• L-arginine:glycine amidinotransferase
• Transamidinase

Background

GATM encodes a mitochondrial enzyme that belongs to the amidinotransferase family. This enzyme is involved in creatine biosynthesis, whereby it catalyzes the transfer of a guanido group from L-arginine to glycine, resulting in guanidinoacetic acid, the immediate precursor of creatine. Mutations in this gene cause arginine:glycine amidinotransferase deficiency, an inborn error of creatine synthesis characterized by mental retardation, language impairment, and behavioral disorders.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GATM