Recombinant Human GATA-1 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human GATA-1 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 123-199 of Human GATA-1

Source: Wheat Germ

Amino Acid Sequence: DLDGKGSTSFLETLKTERLSPDLLTLGPALPSSLPVPNSAYGGPDFSSTFFSPTGSPLNSAAYSSPKLRGTLPLPPC

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
GATA1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
34.21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GATA-1 Protein

  • Eryf1
  • ERYF1GATA-binding protein 1 (globin transcription factor 1)
  • GATA binding protein 1 (globin transcription factor 1)
  • GATA1
  • GATA-1
  • GATA-1erythroid transcription factor
  • GATA-binding factor 1
  • GF-1
  • GF1globin transcription factor 1
  • NF-E1 DNA-binding protein
  • NFE1erythroid transcription factor 1
  • transcription factor GATA1
  • XLTT

Background

This gene encodes a protein which belongs to the GATA family of transcription factors. The protein plays an important role in erythroid development by regulating the switch of fetal hemoglobin to adult hemoglobin. Mutations in this gene have been associated with X-linked dyserythropoietic anemia and thrombocytopenia. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82580
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-87992
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-01488
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF2046
Species: Hu
Applications: WB, Simple Western, ICC
AF2046
Species: Hu
Applications: WB, Simple Western, ICC
NB100-68241
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-14081
Species: Hu
Applications: IHC, IHC-P
NBP2-37380
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
NBP2-48693
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88080
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-27163
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, Flow
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
MAB6799
Species: Hu
Applications: WB, IHC
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-32964
Species: Hu
Applications: Flow, ICC/IF, IHC-Fr
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP

Publications for GATA-1 Partial Recombinant Protein (H00002623-Q01) (0)

There are no publications for GATA-1 Partial Recombinant Protein (H00002623-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GATA-1 Partial Recombinant Protein (H00002623-Q01) (0)

There are no reviews for GATA-1 Partial Recombinant Protein (H00002623-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GATA-1 Partial Recombinant Protein (H00002623-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GATA-1 Products

Bioinformatics Tool for GATA-1 Partial Recombinant Protein (H00002623-Q01)

Discover related pathways, diseases and genes to GATA-1 Partial Recombinant Protein (H00002623-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GATA-1 Partial Recombinant Protein (H00002623-Q01)

Discover more about diseases related to GATA-1 Partial Recombinant Protein (H00002623-Q01).
 

Pathways for GATA-1 Partial Recombinant Protein (H00002623-Q01)

View related products by pathway.

PTMs for GATA-1 Partial Recombinant Protein (H00002623-Q01)

Learn more about PTMs related to GATA-1 Partial Recombinant Protein (H00002623-Q01).
 

Research Areas for GATA-1 Partial Recombinant Protein (H00002623-Q01)

Find related products by research area.

Blogs on GATA-1

There are no specific blogs for GATA-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-3 [Unconjugated]
203-IL-010/CF
GATA-1 Antibody
NBP1-84792

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GATA-1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GATA1
Entrez