GATA-1 Antibody (3G6) - Azide and BSA Free

Western Blot: GATA-1 Antibody (3G6) [H00002623-M06] - Analysis of GATA1 expression in Jurkat (Cat # L017V1).

Sandwich ELISA: GATA-1 Antibody (3G6) [H00002623-M06] - Detection limit for recombinant GST tagged GATA1 is 3 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 3G6
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

GATA-1 Antibody (3G6) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: GATA1 (ENSP00000365858, 123 a.a. ~ 199 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DLDGKGSTSFLETLKTERLSPDLLTLGPALPSSLPVPNSAYGGPDFSSTFFSPTGSPLNSAAYSSPKLRGTLPLPPC
• Specificity: Reacts with GATA binding protein 1 (globin transcription factor 1).
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: GATA1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot
• Application Notes: Antibody reactivity against cell lysate in WB and recombinant protein in ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GATA-1 Antibody (3G6) - Azide and BSA Free

• Eryf1
• ERYF1GATA-binding protein 1 (globin transcription factor 1)
• GATA binding protein 1 (globin transcription factor 1)
• GATA1
• GATA-1
• GATA-1erythroid transcription factor
• GATA-binding factor 1
• GF-1
• GF1globin transcription factor 1
• NF-E1 DNA-binding protein
• NFE1erythroid transcription factor 1
• transcription factor GATA1
• XLTT

Background

This gene encodes a protein which belongs to the GATA family of transcription factors. The protein plays an important role in erythroid development by regulating the switch of fetal hemoglobin to adult hemoglobin. Mutations in this gene have been associated with X-linked dyserythropoietic anemia and thrombocytopenia. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GATA1
• Entrez:
  • 2623(Human)
• Uniprot:
  • NP_002040(Human)