GATA-1 Antibody (3G6)

Images

 
Western Blot: GATA-1 Antibody (3G6) [H00002623-M06] - Analysis of GATA1 expression in Jurkat (Cat # L017V1).
Sandwich ELISA: GATA-1 Antibody (3G6) [H00002623-M06] - Detection limit for recombinant GST tagged GATA1 is 3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3G6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

GATA-1 Antibody (3G6) Summary

Immunogen
GATA1 (ENSP00000365858, 123 a.a. - 199 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DLDGKGSTSFLETLKTERLSPDLLTLGPALPSSLPVPNSAYGGPDFSSTFFSPTGSPLNSAAYSSPKLRGTLPLPPC
Specificity
Reacts with GATA binding protein 1 (globin transcription factor 1).
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GATA1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate in WB and recombinant protein in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GATA-1 Antibody (3G6)

  • Eryf1
  • ERYF1GATA-binding protein 1 (globin transcription factor 1)
  • GATA binding protein 1 (globin transcription factor 1)
  • GATA1
  • GATA-1
  • GATA-1erythroid transcription factor
  • GATA-binding factor 1
  • GF-1
  • GF1globin transcription factor 1
  • NF-E1 DNA-binding protein
  • NFE1erythroid transcription factor 1
  • transcription factor GATA1
  • XLTT

Background

This gene encodes a protein which belongs to the GATA family of transcription factors. The protein plays an important role in erythroid development by regulating the switch of fetal hemoglobin to adult hemoglobin. Mutations in this gene have been associated with X-linked dyserythropoietic anemia and thrombocytopenia. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82580
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-87992
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-01488
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF2046
Species: Hu
Applications: WB, Simple Western, ICC
AF2046
Species: Hu
Applications: WB, Simple Western, ICC
NB100-68241
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-14081
Species: Hu
Applications: IHC, IHC-P
NBP2-37380
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
NBP2-48693
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88080
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-27163
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, Flow
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
MAB6799
Species: Hu
Applications: WB, IHC
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-32964
Species: Hu
Applications: Flow, ICC/IF, IHC-Fr
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP

Publications for GATA-1 Antibody (H00002623-M06) (0)

There are no publications for GATA-1 Antibody (H00002623-M06).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GATA-1 Antibody (H00002623-M06) (0)

There are no reviews for GATA-1 Antibody (H00002623-M06). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GATA-1 Antibody (H00002623-M06) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GATA-1 Products

Bioinformatics Tool for GATA-1 Antibody (H00002623-M06)

Discover related pathways, diseases and genes to GATA-1 Antibody (H00002623-M06). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GATA-1 Antibody (H00002623-M06)

Discover more about diseases related to GATA-1 Antibody (H00002623-M06).
 

Pathways for GATA-1 Antibody (H00002623-M06)

View related products by pathway.

PTMs for GATA-1 Antibody (H00002623-M06)

Learn more about PTMs related to GATA-1 Antibody (H00002623-M06).
 

Research Areas for GATA-1 Antibody (H00002623-M06)

Find related products by research area.

Blogs on GATA-1

There are no specific blogs for GATA-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GATA-1 Antibody (3G6) and receive a gift card or discount.

Bioinformatics

Gene Symbol GATA1
Entrez
Uniprot