| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, ELISA, ICC/IF |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | FITC |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human Gasdermin-C (NP_113603.1). Sequence: MPSMLERISKNLVKEIGSKDLTPVKYLLSATKLRQFVILRKKKDSRSSFWEQSDYVPVEFSLNDILEPSSSVLETVVTGPFHFSDIMIQKHKADMGVNVG |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | GSDMC |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Optimal dilution of this antibody should be experimentally determined. |
| Storage | Store at 4C in the dark. |
| Buffer | PBS |
| Preservative | 0.05% Sodium Azide |
| Purity | Affinity purified |
![Neutralization ErbB3/Her3 Antibody (66223) [Unconjugated]](https://images.novusbio.com/images2/ErbB3_MAB3481_Block_Neutralize_9158.jpg)
![Simple Western CD117/c-kit Antibody [Unconjugated]](https://images.novusbio.com/images2/CD117_AF1356_Simple_Western_17480.jpg)
![Western Blot CD117/c-kit Antibody [Unconjugated]](https://images.novusbio.com/images2/CD117_AF1356_Western_Blot_18637.jpg)
![Immunohistochemistry CD117/c-kit Antibody [Unconjugated]](https://images.novusbio.com/images2/SCF_R_AF1356_Immunohistochemistry_9746.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | GSDMC |
![Flow Cytometry: Rabbit IgG Isotype Control [FITC] [NBP2-24892] - Analysis of TLR7 in Ramos cells using 2 ug of NBP2-24892. Shaded histogram represents FITC-conjugated rabbit IgG isotype control ; red represents anti-TLR7 antibody.](https://images.novusbio.com/images/Rabbit-IgG-Isotype-Control-[FITC]-Flow-Cytometry-NBP2-24892-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [FITC] [NBP2-24892] - Analysis of TLR7 in Ramos cells using 2 ug of NBP2-24892. Shaded histogram represents FITC-conjugated rabbit IgG isotype control ; red represents anti-TLR7 antibody.")