Gasdermin-A Antibody

Images

 
Immunohistochemistry-Paraffin: Gasdermin-A Antibody [NBP2-48564] - Staining in human skin and skeletal muscle tissues.. Corresponding GSDMA RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Gasdermin-A Antibody [NBP2-48564] - Staining of human skin shows strong cytoplasmic positivity in cells in sebaceous gland.
Immunohistochemistry-Paraffin: Gasdermin-A Antibody [NBP2-48564] - Staining of human hair shows strong cytoplasmic positivity in cortex, cuticle, inner root sheath and inner most layer of external root sheath.
Immunohistochemistry-Paraffin: Gasdermin-A Antibody [NBP2-48564] - Staining of human skin shows high expression.
Immunohistochemistry-Paraffin: Gasdermin-A Antibody [NBP2-48564] - Staining in human skin and skeletal muscle tissues using anti-GSDMA antibody. Corresponding GSDMA RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Gasdermin-A Antibody [NBP2-48564] - Staining of human skeletal muscle shows no positivity in myocytes.
Immunohistochemistry-Paraffin: Gasdermin-A Antibody [NBP2-48564] - Staining of human skin shows moderate to strong cytoplasmic positivity in keratinocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Gasdermin-A Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: VGALTELSEAQQKLLVKSMEKKILPVQLKLVESTMEQNFLLDKEGVFPLQPELLSSLGDEELTLTEALVGLSGLEVQRSGPQYMWDPDTLPRLCALYAGLSLLQQLTKAS
Specificity
Specificity of human Gasdermin-A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GSDMA
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Gasdermin-A Recombinant Protein Antigen (NBP2-48564PEP)

Reactivity Notes

Mouse (88%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Gasdermin-A Antibody

  • FKSG9
  • Gasdermin 1
  • Gasdermin A
  • Gasdermin
  • Gasdermin-1
  • GSDM
  • GSDM1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33648
Species: Hu
Applications: IHC, IHC-P
NBP2-33422
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01808
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow
NBP2-33671
Species: Hu
Applications: IHC, IHC-P
NBP2-24495
Species: Hu, Pm
Applications: WB, ICC/IF
MAB3765
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow
NBP1-91926
Species: Hu
Applications: IHC, IHC-P
AF4856
Species: Hu, Mu, Rt
Applications: WB
NBP1-87689
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89558
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-75015
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-48564
Species: Hu
Applications: IHC, IHC-P

Publications for Gasdermin-A Antibody (NBP2-48564) (0)

There are no publications for Gasdermin-A Antibody (NBP2-48564).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Gasdermin-A Antibody (NBP2-48564) (0)

There are no reviews for Gasdermin-A Antibody (NBP2-48564). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Gasdermin-A Antibody (NBP2-48564) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Gasdermin-A Antibody (NBP2-48564)

Discover related pathways, diseases and genes to Gasdermin-A Antibody (NBP2-48564). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Gasdermin-A Antibody (NBP2-48564)

Discover more about diseases related to Gasdermin-A Antibody (NBP2-48564).
 

Pathways for Gasdermin-A Antibody (NBP2-48564)

View related products by pathway.

Blogs on Gasdermin-A

There are no specific blogs for Gasdermin-A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Gasdermin-A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GSDMA