GSDMDC1 Antibody

Images

 
Orthogonal Strategies: Western Blot: GSDMDC1 Antibody [NBP2-33422] - Analysis in human cell lines U2OS and HEK293 using anti-GSDMD antibody. Corresponding GSDMD RNA-seq data are presented for the same cell lines. ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IP, KD, KO
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

GSDMDC1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: GDNVYVVTEVLQTQKEVEVTRTHKREGSGRFSLPGATCLQGEGQGHLSQKKTVTIPSGSTLAFRVAQLVIDSDLDVLLFPDKKQRTFQPPATGHKRSTS
Specificity
Specificity of human GSDMDC1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GSDMD
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunoprecipitation
  • Knockdown Validated
  • Knockout Validated
Application Notes
ICC/IF reactivity reported in (PMID: 30250284). WB, KD reactivity reported in (PMID: 31216481). Use in Immunoprecipitation reported in scientific literature (PMID:33053349).
Control Peptide
GSDMDC1 Recombinant Protein Antigen (NBP2-33422PEP)
Publications
Read Publications using
NBP2-33422 in the following applications:

  • 4 publications
  • IP
    2 publications
  • KD
    2 publications
  • KO
    2 publications
  • WB
    21 publications

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 30473634). Use in Rat reported in scientific literature (PMID:32245616).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GSDMDC1 Antibody

  • DF5L
  • DFNA5L
  • FLJ12150
  • gasdermin D
  • gasdermin domain containing 1
  • Gasdermin domain-containing protein 1
  • gasdermin-D
  • GSDMD N
  • GSDMDC1
  • GSDMD-N

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33648
Species: Hu
Applications: IHC, IHC-P
NBP1-91926
Species: Hu
Applications: IHC, IHC-P
NBP2-80426
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
NBP1-87243
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-16273
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-03341
Species: Hu
Applications: WB, IP
NBP2-01732
Species: Hu, Mu, Rt, Ca, Pm, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF6379
Species: Hu
Applications: WB
NBP1-30961
Species: Hu
Applications: WB, ChIP, IHC, IHC-P
NLS921
Species: Hu, Bv
Applications: WB, IHC, IHC-P, ICC
AF5786
Species: Hu, Mu
Applications: WB
H00001719-M01
Species: Hu, Mu, Rt, Ye
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP2-67599
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-49426
Species: Hu
Applications: IHC, IHC-P
NBP1-84781
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91658
Species: Hu
Applications: IHC, IHC-P
NBP2-33422
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP, KD, KO

Publications for GSDMDC1 Antibody (NBP2-33422)(32)

We have publications tested in 3 confirmed species: Human, Mouse, Rat.

We have publications tested in 5 applications: ICC/IF, IP, KD, KO, WB.


Filter By Application
ICC/IF
(4)
IP
(2)
KD
(2)
KO
(2)
WB
(21)
All Applications
Filter By Species
Human
(16)
Mouse
(8)
Rat
(2)
All Species
Showing Publications 1 - 10 of 32. Show All 32 Publications.
Publications using NBP2-33422 Applications Species
Linder A, Bauernfried S, Cheng Y et al. CARD8 inflammasome activation triggers pyroptosis in human T cells EMBO J. Aug 25 2020 [PMID: 32840892] (WB, Human) WB Human
Johnson DC, Okondo MC, Orth EL et al. DPP8/9 inhibitors activate the CARD8 inflammasome in resting lymphocytes Cell Death Dis Aug 14 2020 [PMID: 32796818] (WB, KO, Human, Mouse, Rat) WB, KO Human, Mouse, Rat
Beckwith KS, Beckwith MS, Ullmann S et al. Plasma membrane damage causes NLRP3 activation and pyroptosis during Mycobacterium tuberculosis infection bioRxiv Aug 28 2019 (Human) Human
Boal-Carvalho I, Mazel-Sanchez B, Silva F et al. Influenza A viruses limit NLRP3-NEK7-complex formation and pyroptosis in human macrophages EMBO Rep Nov 12 2020 [PMID: 33180976] (WB) WB
Lichtenegger S, Stiehler J, Saiger S et al. Burkholderia pseudomallei triggers canonical inflammasome activation in a human primary macrophage-based infection model Aging (Albany NY) Oct 24 2020 [PMID: 33137811] (IP, ICC/IF, Human) IP, ICC/IF Human
Chui AJ, Griswold AR, Taabazuing CY et al. Activation of the CARD8 Inflammasome Requires a Disordered Region Cell Rep Oct 13 2020 [PMID: 33053349] (WB, IP, Human) WB, IP Human
Fei L, Jingyuan X, Fangte L et al. Preconditioning with rHMGB1 ameliorates lung ischemia-reperfusion injury by inhibiting alveolar macrophage pyroptosis via the Keap1/Nrf2/HO-1 signaling pathway J Transl Med Aug 5 2020 [PMID: 32758258] (ICC/IF, Mouse) ICC/IF Mouse
Chen H, Gan X, Li Y et al. NLRP12- and NLRC4-mediated corneal epithelial pyroptosis is driven by GSDMD cleavage accompanied by IL-33 processing in dry eye Ocul Surf Jul 28 2020 [PMID: 32735949] (WB, ICC/IF, Mouse) WB, ICC/IF Mouse
Yang F, Zhu W, Cai X et al. Minocycline alleviates NLRP3 inflammasome-dependent pyroptosis in monosodium glutamate-induced depressive rats Biochem. Biophys. Res. Commun. Apr 1 2020 [PMID: 32245616] (WB, Rat) WB Rat
Wen S, Wang ZH, Zhang CX et al. Caspase-3 Promotes Diabetic Kidney Disease Through Gasdermin E-Mediated Progression to Secondary Necrosis During Apoptosis Diabetes Metab Syndr Obes Feb 10 2020 [PMID: 32104028] (WB, Human, Mouse) WB Human, Mouse
Show All 32 Publications.

Reviews for GSDMDC1 Antibody (NBP2-33422) (0)

There are no reviews for GSDMDC1 Antibody (NBP2-33422). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GSDMDC1 Antibody (NBP2-33422) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional GSDMDC1 Products

Bioinformatics Tool for GSDMDC1 Antibody (NBP2-33422)

Discover related pathways, diseases and genes to GSDMDC1 Antibody (NBP2-33422). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GSDMDC1 Antibody (NBP2-33422)

Discover more about diseases related to GSDMDC1 Antibody (NBP2-33422).
 

Pathways for GSDMDC1 Antibody (NBP2-33422)

View related products by pathway.

Blogs on GSDMDC1

There are no specific blogs for GSDMDC1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GSDMDC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GSDMD
Uniprot