GSDMDC1 Antibody

Western Blot: GSDMDC1 Antibody [NBP2-33422] - Analysis in human cell lines U2OS and HEK293 using anti-GSDMD antibody. Corresponding GSDMD RNA-seq data are presented for the same cell lines. Loading control: anti-HSP90B1.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IP, KD, KO
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

GSDMDC1 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: GDNVYVVTEVLQTQKEVEVTRTHKREGSGRFSLPGATCLQGEGQGHLSQKKTVTIPSGSTLAFRVAQLVIDSDLDVLLFPDKKQRTFQPPATGHKRSTS
• Specificity: Specificity of human GSDMDC1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GSDMD
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunoprecipitation
  • Knockdown Validated
  • Knockout Validated
• Application Notes: ICC/IF reactivity reported in (PMID: 30250284). WB, KD reactivity reported in (PMID: 31216481). Use in Immunoprecipitation reported in scientific literature (PMID:33053349).
• Control Peptide:

  GSDMDC1 Recombinant Protein Antigen (NBP2-33422PEP)

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 30473634). Use in Rat reported in scientific literature (PMID:32245616).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for GSDMDC1 Antibody

• DF5L
• DFNA5L
• FLJ12150
• gasdermin D
• gasdermin domain containing 1
• Gasdermin domain-containing protein 1
• gasdermin-D
• GSDMD N
• GSDMDC1
• GSDMD-N

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for GSDMDC1 Antibody (NBP2-33422)(32)

Publications using NBP2-33422

• Linder A, Bauernfried S, Cheng Y et al. CARD8 inflammasome activation triggers pyroptosis in human T cells EMBO J. Aug 25 2020 [PMID: 32840892] (WB, Human)
• Johnson DC, Okondo MC, Orth EL et al. DPP8/9 inhibitors activate the CARD8 inflammasome in resting lymphocytes Cell Death Dis Aug 14 2020 [PMID: 32796818] (WB, KO, Human, Mouse, Rat)
• Beckwith KS, Beckwith MS, Ullmann S et al. Plasma membrane damage causes NLRP3 activation and pyroptosis during Mycobacterium tuberculosis infection bioRxiv Aug 28 2019 (Human)
• Boal-Carvalho I, Mazel-Sanchez B, Silva F et al. Influenza A viruses limit NLRP3-NEK7-complex formation and pyroptosis in human macrophages EMBO Rep Nov 12 2020 [PMID: 33180976] (WB)
• Lichtenegger S, Stiehler J, Saiger S et al. Burkholderia pseudomallei triggers canonical inflammasome activation in a human primary macrophage-based infection model Aging (Albany NY) Oct 24 2020 [PMID: 33137811] (IP, ICC/IF, Human)
• Chui AJ, Griswold AR, Taabazuing CY et al. Activation of the CARD8 Inflammasome Requires a Disordered Region Cell Rep Oct 13 2020 [PMID: 33053349] (WB, IP, Human)
• Fei L, Jingyuan X, Fangte L et al. Preconditioning with rHMGB1 ameliorates lung ischemia-reperfusion injury by inhibiting alveolar macrophage pyroptosis via the Keap1/Nrf2/HO-1 signaling pathway J Transl Med Aug 5 2020 [PMID: 32758258] (ICC/IF, Mouse)
• Chen H, Gan X, Li Y et al. NLRP12- and NLRC4-mediated corneal epithelial pyroptosis is driven by GSDMD cleavage accompanied by IL-33 processing in dry eye Ocul Surf Jul 28 2020 [PMID: 32735949] (WB, ICC/IF, Mouse)
• Yang F, Zhu W, Cai X et al. Minocycline alleviates NLRP3 inflammasome-dependent pyroptosis in monosodium glutamate-induced depressive rats Biochem. Biophys. Res. Commun. Apr 1 2020 [PMID: 32245616] (WB, Rat)
• Wen S, Wang ZH, Zhang CX et al. Caspase-3 Promotes Diabetic Kidney Disease Through Gasdermin E-Mediated Progression to Secondary Necrosis During Apoptosis Diabetes Metab Syndr Obes Feb 10 2020 [PMID: 32104028] (WB, Human, Mouse)
• Ball DP, Taabazuing CY, Griswold AR et al. Caspase-1 interdomain linker cleavage is required for pyroptosis Life Sci Alliance Mar 1 2020 [PMID: 32051255] (WB, Human)
• Ma J, Ramachandran M, Jin C et al. Characterization of virus-mediated immunogenic cancer cell death and the consequences for oncolytic virus-based immunotherapy of cancer Cell Death Dis Jan 22 2020 [PMID: 31969562] (WB, Human)
• Grossi S, Fenini G, Kockmann T, et al. Inactivation of the cytoprotective major vault protein by caspase-1 and -9 in epithelial cells during apoptosis: caspase-1 and -9 inactivate the major vault protein J. Invest. Dermatol. Dec 23 2019 [PMID: 31877317]
• Pandori WJ, Lima TS, Mallya S et al. Toxoplasma gondii activates a Syk-CARD9-NF-kappaB signaling axis and gasdermin D-independent release of IL-1beta during infection of primary human monocytes PLoS Pathog. Aug 1 2019 [PMID: 31449558] (WB, KO, Human)
• Burgener SS, Leborgne NGF, Snipas SJ et al. Cathepsin G Inhibition by Serpinb1 and Serpinb6 Prevents Programmed Necrosis in Neutrophils and Monocytes and Reduces GSDMD-Driven Inflammation. Cell Rep. 2019 Jun 18 [PMID: 31216481] (KD, WB, Mouse)
• Burgener SS, Leborgne NGF, Snipas SJ et al. Cathepsin G Inhibition by Serpinb1 and Serpinb6 Prevents Programmed Necrosis in Neutrophils and Monocytes and Reduces GSDMD-Driven Inflammation Cell Rep 2019 Jun 18 [PMID: 31216481] (KD, WB, Mouse)
• Kerr NA, de Rivero Vaccari JP, Umland O et al. Human Lung Cell Pyroptosis Following Traumatic Brain Injury. Cells Jan 18 2019 [PMID: 30669285] (WB, Human)
• Mejias NH, Martinez CC, Stephens ME, de Rivero Vaccari JP. Contribution of the inflammasome to inflammaging. J Inflamm (Lond). Nov 16 2018 [PMID: 30473634] (Mouse)
• Semino C, Carta S, Gattorno M et al. Progressive waves of IL-1B release by primary human monocytes via sequential activation of vesicular and gasdermin D-mediated secretory pathways Cell Death Dis Oct 23 2018 [PMID: 30352992] (WB)
• Bachovchin D, Chui A, Okondo M et al. N-terminal degradation activates the Nlrp1b inflammasome bioRxiv May 9 2018
• Taabazuing CY, Okondo MC, Bachovchin DA. Pyroptosis and Apoptosis Pathways Engage in Bidirectional Crosstalk in Monocytes and Macrophages. Cell Chem Biol. Apr 20 2017 [PMID: 28392147]
• Del Olmo ID Priming Is Dispensable For NLRP3 Inflammasome Activation In Human Monocytes BioRxiv Jan 1 2020 (WB, Human)
• Xu W, Cao L, Hao H Apaf-1 Pyroptosome Senses Mitochondrial Permeability Transition bioRxiv Jan 1 2020 (WB, Mouse)
• Zhang Z, Shao X, Jiang N et al. Caspase-11-mediated tubular epithelial pyroptosis underlies contrast-induced acute kidney injury. Cell Death Dis Sep 24 2018 [PMID: 30250284] (ICC/IF, Human)
• Kulkarni HS, Elvington ML, Perng YC et al. Intracellular C3 Protects Human Airway Epithelial Cells from Stress-Associated Cell Death. Am. J. Respir. Cell Mol. Biol. Aug 29 2018 [PMID: 30156437] (WB, Human)
• Johnson DC, Taabazuing CY, Okondo MC et al. DPP8/DPP9 inhibitor-induced pyroptosis for treatment of acute myeloid leukemia. Nat. Med. Jul 2 2018 [PMID: 29967349] (WB, Human)
• Evavold CL, Ruan J, Tan Y et al. The Pore-Forming Protein Gasdermin D Regulates Interleukin-1 Secretion from Living Macrophages. Immunity [PMID: 29195811] (WB, Human)
• Evavold CL, Ruan J, Tan Y et al. The Pore-Forming Protein Gasdermin D Regulates Interleukin-1 Secretion from Living Macrophages. Immunity 2017 Nov 28 [PMID: 29195211] (WB, Human)
• Okondo MC, Johnson DC, Sridharan R et al. DPP8 and DPP9 inhibition induces pro-caspase-1-dependent monocyte and macrophage pyroptosis. Nat. Chem. Biol. Nov 7 2016 [PMID: 27820798]
• Liu X, Zhang Z, Ruan J et al. Inflammasome-activated gasdermin D causes pyroptosis by forming membrane pores Nature 2016 Jul 07 [PMID: 27383986]
• Shi J, Zhao Y, Wang K et al. Cleavage of GSDMD by inflammatory caspases determines pyroptotic cell death. Nature 2015 Sep 16 [PMID: 26375003] (WB)

Bioinformatics

• Gene Symbol: GSDMD
• Uniprot:
  • P57764(Human)