GAS7 Antibody (NBP2-49422)

Images

 
Immunocytochemistry/ Immunofluorescence: GAS7 Antibody [NBP2-49422] - Immunofluorescent staining of human cell line SK-MEL-30 shows localization to plasma membrane & actin filaments.
Immunohistochemistry-Paraffin: GAS7 Antibody [NBP2-49422] - Staining of human cerebral cortex shows cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GAS7 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids:SAKLHSEVEKPLMNFRENFKKDMKKCDHHIADLRKQLASRYASVEKARKALTERQRDLEMKTQQLEIKLSNKTEEDIKKGRRKS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GAS7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:5000 - 1:10000
  • Immunohistochemistry-Paraffin
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GAS7 Antibody

  • GAS-7
  • growth arrest-specific 7
  • KIAA0394growth arrest-specific protein 7
  • MGC1348
  • MLL/GAS7 fusion protein
  • MLL/GAS7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-248
Species: Hu
Applications: WB, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NBP2-00932
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-32356
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
MAB6460
Species: Hu
Applications: WB, IHC
H00009322-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NB110-59086
Species: Hu, Pm, Bv(-), Mu(-), Rt(-)
Applications: WB, IHC, IHC-P

Publications for GAS7 Antibody (NBP2-49422) (0)

There are no publications for GAS7 Antibody (NBP2-49422).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GAS7 Antibody (NBP2-49422) (0)

There are no reviews for GAS7 Antibody (NBP2-49422). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for GAS7 Antibody (NBP2-49422) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GAS7 Products

Related Products by Gene

Bioinformatics Tool for GAS7 Antibody (NBP2-49422)

Discover related pathways, diseases and genes to GAS7 Antibody (NBP2-49422). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GAS7 Antibody (NBP2-49422)

Discover more about diseases related to GAS7 Antibody (NBP2-49422).
 

Pathways for GAS7 Antibody (NBP2-49422)

View related products by pathway.

PTMs for GAS7 Antibody (NBP2-49422)

Learn more about PTMs related to GAS7 Antibody (NBP2-49422).
 

Research Areas for GAS7 Antibody (NBP2-49422)

Find related products by research area.

Blogs on GAS7

There are no specific blogs for GAS7, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GAS7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GAS7

Customers Who Bought This Also Bought