Recombinant Human GAP-43 Protein

Images

 
SDS-Page: GAP-43 Recombinant Protein [H00002596-P01]

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human GAP-43 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-238 of Human GAP43 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MLCCMRRTKQVEKNDDDQKIEQDGIKPEDKAHKAATKIQASFRGHITRKKLKGEKKDDVQAAEAEANKKDEAPVADGVEKKGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKGEGDAATEQAAPQAPASSEEKAGSAETESATKASTDNSPSSKAEDAPAKEEPKQADVPAAVTAAAATTPAAEDAAAKATAQPPTETGESSQAEENIEAVDETKPKESARQDEGKEEEPEADQEHA

Protein/Peptide Type
Recombinant Protein
Gene
GAP43

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Reviewed Applications
Read 1 Review rated 5
using
H00002596-P01 in the following application:

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GAP-43 Protein

  • Axonal membrane protein GAP-43
  • B-50
  • Basp2
  • calmodulin-binding protein P-57
  • GAP43
  • GAP-43
  • growth associated protein 43
  • Growth-associated protein 43
  • nerve growth-related peptide GAP43
  • Neural phosphoprotein B-50
  • Neuromodulin
  • neuron growth-associated protein 43
  • PP46
  • protein F1

Background

The protein encoded by this gene has been termed a 'growth' or 'plasticity' protein because it is expressed at high levels in neuronal growth cones during development and axonal regeneration. This encoded protein is considered a crucial component of an effective regenerative response in the nervous system.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-143
Species: Hu, Mu, Rt, Po, Ca, Ch, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF7947
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP1-98474
Species: Hu
Applications: WB
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-653
Species: Hu, Mu, Rt, Ch, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NB300-213
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr
NB110-74753
Species: Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
PPS010
Species: Hu, Mu, Rt, Bv, Ch, Xp, Ze
Applications: WB
NBP1-05164
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
AF1052
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P

Publications for GAP-43 Recombinant Protein (H00002596-P01) (0)

There are no publications for GAP-43 Recombinant Protein (H00002596-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for GAP-43 Recombinant Protein (H00002596-P01) (1) 51

Average Rating: 5
(Based on 1 review)

Reviews using H00002596-P01:
Filter by Applications
All Applications
Filter by Species
All Species
Images Ratings Applications Species Date Details
 
reviewed by:
Jie Zhu
02/03/2017
View

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GAP-43 Recombinant Protein (H00002596-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GAP-43 Products

Bioinformatics Tool for GAP-43 Recombinant Protein (H00002596-P01)

Discover related pathways, diseases and genes to GAP-43 Recombinant Protein (H00002596-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GAP-43 Recombinant Protein (H00002596-P01)

Discover more about diseases related to GAP-43 Recombinant Protein (H00002596-P01).
 

Pathways for GAP-43 Recombinant Protein (H00002596-P01)

View related products by pathway.

PTMs for GAP-43 Recombinant Protein (H00002596-P01)

Learn more about PTMs related to GAP-43 Recombinant Protein (H00002596-P01).
 

Research Areas for GAP-43 Recombinant Protein (H00002596-P01)

Find related products by research area.

Blogs on GAP-43.

Synapsin I: Implicated in synaptic activity across a diverse range of studies
Synapsins are a family of neuronal proteins that are most renowned for their activity in modulating the pre-synaptic terminal.  Synapsin’s behavior is regulated by protein kinases and phosphatases, which alter the way that synapsin’s i...  Read full blog post.

Customers Who Bought This Also Bought

GAP-43 Antibody
NB300-143
BDNF [Unconjugated]
248-BD-005/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

 
Jie Zhu
02/03/2017
Application:
Species:

Bioinformatics

Gene Symbol GAP43
Entrez