Recombinant Human GAP-43 GST (N-Term) Protein

SDS-Page: GAP-43 Recombinant Protein [H00002596-P01]

Product Discontinued

Recombinant Human GAP-43 GST (N-Term) Protein Summary

• Description: A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-238 of Human GAP43 full-length ORF
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: MLCCMRRTKQVEKNDDDQKIEQDGIKPEDKAHKAATKIQASFRGHITRKKLKGEKKDDVQAAEAEANKKDEAPVADGVEKKGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKGEGDAATEQAAPQAPASSEEKAGSAETESATKASTDNSPSSKAEDAPAKEEPKQADVPAAVTAAAATTPAAEDAAAKATAQPPTETGESSQAEENIEAVDETKPKESARQDEGKEEEPEADQEHA

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Full Length Recombinant Protein
• Gene: GAP43
• Purity: >10% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
• Theoretical MW: 51.92 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >10% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GAP-43 GST (N-Term) Protein

• Axonal membrane protein GAP-43
• B-50
• Basp2
• calmodulin-binding protein P-57
• GAP43
• GAP-43
• growth associated protein 43
• Growth-associated protein 43
• nerve growth-related peptide GAP43
• Neural phosphoprotein B-50
• Neuromodulin
• neuron growth-associated protein 43
• PP46
• protein F1

Background

The protein encoded by this gene has been termed a 'growth' or 'plasticity' protein because it is expressed at high levels in neuronal growth cones during development and axonal regeneration. This encoded protein is considered a crucial component of an effective regenerative response in the nervous system.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Review for GAP-43 Recombinant Protein (H00002596-P01) (1)

Average Rating: 5

(Based on 1 review)

reviewed by: Jie Zhu Binding assay/Protein-protein interaction 02/03/2017

Summary

• Application: Binding assay/Protein-protein interaction

Bioinformatics

• Gene Symbol: GAP43