| Description | Quality control test: Antibody reactive against mammalian transfected lysate. |
| Immunogen | GAP43 (NP_002036.1, 1 a.a. - 238 a.a.) full-length human protein. MLCCMRRTKQVEKNDDDQKIEQDGIKPEDKAHKAATKIQASFRGHITRKKLKGEKKDDVQAAEAEANKKDEAPVADGVEKKGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKGEGDAATEQAAPQAPASSEEKAGSAETESATKASTDNSPSSKAEDAPAKEEPKQADVPAAVTAAAATTPAAEDAAAKATAQPPTETGESSQAEENIEAVDETKPKESARQDEGKEEEPEADQEHA |
| Marker | Neuronal Marker |
| Specificity | GAP43 - growth associated protein 43, |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | GAP43 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for GAP-43 Antibody (H00002596-D01P)Find related products by research area.
|
|
Synapsin I: Implicated in synaptic activity across a diverse range of studies Synapsins are a family of neuronal proteins that are most renowned for their activity in modulating the pre-synaptic terminal. Synapsin’s behavior is regulated by protein kinases and phosphatases, which alter the way that synapsin’s i... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | GAP43 |
| Uniprot |
|