GAP-43 Antibody

Images

 
Western Blot: GAP-43 Antibody [H00002596-D01P] - Analysis of GAP43 expression in transfected 293T cell line by GAP43 polyclonal antibody.Lane 1: GAP43 transfected lysate(24.80 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GAP-43 Antibody Summary

Immunogen
GAP43 (NP_002036.1, 1 a.a. - 238 a.a.) full-length human protein. MLCCMRRTKQVEKNDDDQKIEQDGIKPEDKAHKAATKIQASFRGHITRKKLKGEKKDDVQAAEAEANKKDEAPVADGVEKKGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKGEGDAATEQAAPQAPASSEEKAGSAETESATKASTDNSPSSKAEDAPAKEEPKQADVPAAVTAAAATTPAAEDAAAKATAQPPTETGESSQAEENIEAVDETKPKESARQDEGKEEEPEADQEHA
Marker
Neuronal Marker
Specificity
GAP43 - growth associated protein 43,
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GAP43
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GAP-43 Antibody

  • Axonal membrane protein GAP-43
  • B-50
  • Basp2
  • calmodulin-binding protein P-57
  • GAP43
  • GAP-43
  • growth associated protein 43
  • Growth-associated protein 43
  • nerve growth-related peptide GAP43
  • Neural phosphoprotein B-50
  • Neuromodulin
  • neuron growth-associated protein 43
  • PP46
  • protein F1

Background

The protein encoded by this gene has been termed a 'growth' or 'plasticity' protein because it is expressed at high levels in neuronal growth cones during development and axonal regeneration. This protein is considered a crucial component of an effective regenerative response in the nervous system. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-143
Species: Hu, Mu, Rt, Po, Ca, Ch, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF7947
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP1-98474
Species: Hu
Applications: WB
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-653
Species: Hu, Mu, Rt, Ch, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NB300-213
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr
NB110-74753
Species: Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
PPS010
Species: Hu, Mu, Rt, Bv, Ch, Xp, Ze
Applications: WB
NBP1-05164
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
AF1052
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P

Publications for GAP-43 Antibody (H00002596-D01P) (0)

There are no publications for GAP-43 Antibody (H00002596-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GAP-43 Antibody (H00002596-D01P) (0)

There are no reviews for GAP-43 Antibody (H00002596-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GAP-43 Antibody (H00002596-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GAP-43 Products

Bioinformatics Tool for GAP-43 Antibody (H00002596-D01P)

Discover related pathways, diseases and genes to GAP-43 Antibody (H00002596-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GAP-43 Antibody (H00002596-D01P)

Discover more about diseases related to GAP-43 Antibody (H00002596-D01P).
 

Pathways for GAP-43 Antibody (H00002596-D01P)

View related products by pathway.

PTMs for GAP-43 Antibody (H00002596-D01P)

Learn more about PTMs related to GAP-43 Antibody (H00002596-D01P).
 

Research Areas for GAP-43 Antibody (H00002596-D01P)

Find related products by research area.

Blogs on GAP-43.

Synapsin I: Implicated in synaptic activity across a diverse range of studies
Synapsins are a family of neuronal proteins that are most renowned for their activity in modulating the pre-synaptic terminal.  Synapsin’s behavior is regulated by protein kinases and phosphatases, which alter the way that synapsin’s i...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GAP-43 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GAP43
Entrez
Uniprot