GAP-43 Antibody (3C11)

Images

 
Western Blot: GAP-43 Antibody (3C11) [H00002596-M01] - Analysis of GAP43 expression in transfected 293T cell line by GAP43 monoclonal antibody (M01), clone 3C11.Lane 1: GAP43 transfected lysate(24.8 KDa).Lane 2: ...read more
ELISA: GAP-43 Antibody (3C11) [H00002596-M01] - Detection limit for recombinant GST tagged GAP43 is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3C11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

GAP-43 Antibody (3C11) Summary

Immunogen
GAP43 (AAH07936, 1 a.a. - 238 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MLCCMRRTKQVEKNDDDQKIEQDGIKPEDKAHKAATKIQASFRGHITRKKLKGEKKDDVQAAEAEANKKDEAPVADGVEKKGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKGEGDAATEQAAPQAPASSEEKAGSAETESATKASTDNSPSSKAEDAPAKEEPKQADVPAAVTAAAATTPAAEDAAAKATAQPPTETGESSQAEENIEAVDETKPKESARQDEGKEEEPEADQEHA
Marker
Neuronal Marker
Specificity
GAP43 - growth associated protein 43 (3C11)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GAP43
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GAP-43 Antibody (3C11)

  • Axonal membrane protein GAP-43
  • B-50
  • Basp2
  • calmodulin-binding protein P-57
  • GAP43
  • GAP-43
  • growth associated protein 43
  • Growth-associated protein 43
  • nerve growth-related peptide GAP43
  • Neural phosphoprotein B-50
  • Neuromodulin
  • neuron growth-associated protein 43
  • PP46
  • protein F1

Background

The protein encoded by this gene has been termed a 'growth' or 'plasticity' protein because it is expressed at high levels in neuronal growth cones during development and axonal regeneration. This protein is considered a crucial component of an effective regenerative response in the nervous system. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-143
Species: Hu, Mu, Rt, Po, Ca, Ch, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF7947
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP1-98474
Species: Hu
Applications: WB
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-653
Species: Hu, Mu, Rt, Ch, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NB300-213
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr
NB110-74753
Species: Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
PPS010
Species: Hu, Mu, Rt, Bv, Ch, Xp, Ze
Applications: WB
NBP1-05164
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
AF1052
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P

Publications for GAP-43 Antibody (H00002596-M01) (0)

There are no publications for GAP-43 Antibody (H00002596-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GAP-43 Antibody (H00002596-M01) (0)

There are no reviews for GAP-43 Antibody (H00002596-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GAP-43 Antibody (H00002596-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GAP-43 Products

Bioinformatics Tool for GAP-43 Antibody (H00002596-M01)

Discover related pathways, diseases and genes to GAP-43 Antibody (H00002596-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GAP-43 Antibody (H00002596-M01)

Discover more about diseases related to GAP-43 Antibody (H00002596-M01).
 

Pathways for GAP-43 Antibody (H00002596-M01)

View related products by pathway.

PTMs for GAP-43 Antibody (H00002596-M01)

Learn more about PTMs related to GAP-43 Antibody (H00002596-M01).
 

Research Areas for GAP-43 Antibody (H00002596-M01)

Find related products by research area.

Blogs on GAP-43.

Synapsin I: Implicated in synaptic activity across a diverse range of studies
Synapsins are a family of neuronal proteins that are most renowned for their activity in modulating the pre-synaptic terminal.  Synapsin’s behavior is regulated by protein kinases and phosphatases, which alter the way that synapsin’s i...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GAP-43 Antibody (3C11) and receive a gift card or discount.

Bioinformatics

Gene Symbol GAP43
Entrez
Uniprot