gamma Sarcoglycan Recombinant Protein Antigen

Images

 
There are currently no images for gamma Sarcoglycan Protein (NBP1-90299PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

gamma Sarcoglycan Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SGCG.

Source: E. coli

Amino Acid Sequence: YAKEIHSRVDSSLLLQSTQNVTVNARNSEGEVTGRLKVGPKMVEVQNQQFQINSNDGKPLFTVDEKEVVVGTDKLRVTGPEGALFEHSVETPLVRADPFQD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SGCG
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90299.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for gamma Sarcoglycan Recombinant Protein Antigen

  • 35 kDa dystrophin-associated glycoprotein
  • 35DAG
  • A4
  • DAGA4
  • DAGA4,35kD dystrophin-associated glycoprotein
  • DMDA
  • DMDA1
  • gamma sarcoglycan
  • gamma-Sarcoglycan
  • gamma-SG
  • LGMD2C
  • LGMDR5
  • MAM
  • MGC130048
  • sarcoglycan, gamma (35kD dystrophin-associated glycoprotein)
  • sarcoglycan, gamma (35kDa dystrophin-associated glycoprotein)
  • SCARMD2
  • SCG3
  • SCG3LGMD2C
  • TYPE

Background

gamma Sarcoglycan encodes gamma-sarcoglycan, one of several sarcolemmal transmembrane glycoproteins that interact with dystrophin. The dystrophin-glycoprotein complex (DGC) spans the sarcolemma and is comprised of dystrophin, syntrophin, alpha- and beta-dystroglycans and sarcoglycans. The DGC provides a structural link between the subsarcolemmal cytoskeleton and the extracellular matrix of muscle cells. Defects in the encoded protein can lead to early onset autosomal recessive muscular dystrophy, in particular limb-girdle muscular dystrophy, type 2C (LGMD2C). [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67150
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
NBP1-59069
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-17255
Species: Hu
Applications: ICC/IF, WB
NBP1-89333
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
AF6457
Species: Hu
Applications: WB
NBP2-73857
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, IHC, WB
NBP2-45946
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-13075
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-25196
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, In vitro, WB
NBP1-88927
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89953
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-34234
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P
NBP1-90297
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-43435
Species: Hu, Mu
Applications: Flow, WB
H00728695-B01P
Species: Hu
Applications: ICC/IF, IP, WB
NBP2-36776
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-47829
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NB200-540
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-38449
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for gamma Sarcoglycan Protein (NBP1-90299PEP) (0)

There are no publications for gamma Sarcoglycan Protein (NBP1-90299PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for gamma Sarcoglycan Protein (NBP1-90299PEP) (0)

There are no reviews for gamma Sarcoglycan Protein (NBP1-90299PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for gamma Sarcoglycan Protein (NBP1-90299PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional gamma Sarcoglycan Products

Bioinformatics Tool for gamma Sarcoglycan Protein (NBP1-90299PEP)

Discover related pathways, diseases and genes to gamma Sarcoglycan Protein (NBP1-90299PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for gamma Sarcoglycan Protein (NBP1-90299PEP)

Discover more about diseases related to gamma Sarcoglycan Protein (NBP1-90299PEP).
 

Pathways for gamma Sarcoglycan Protein (NBP1-90299PEP)

View related products by pathway.

Blogs on gamma Sarcoglycan

There are no specific blogs for gamma Sarcoglycan, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our gamma Sarcoglycan Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SGCG