Recombinant Human gamma Sarcoglycan Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human gamma Sarcoglycan Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 191-290 of Human SGCG partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:DLRLESPTRSLSMDAPRGVHIQAHAGKIEALSQMDILFHSSDGMLVLDAETVCLPKLVQGTWGPSGSSQSLYEICVCPDGKLYLSVAGVSTTCQEHSHIC

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
SGCG

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human gamma Sarcoglycan Protein

  • 35 kDa dystrophin-associated glycoprotein
  • 35DAG
  • A4
  • DAGA4,35kD dystrophin-associated glycoprotein
  • DMDA
  • DMDA1
  • gamma sarcoglycan
  • gamma-sarcoglycan
  • gamma-SG
  • MAM
  • MGC130048
  • sarcoglycan, gamma (35kD dystrophin-associated glycoprotein)
  • sarcoglycan, gamma (35kDa dystrophin-associated glycoprotein)
  • SCARMD2
  • SCG3LGMD2C
  • TYPE

Background

Gamma-sarcoglycan is one of several sarcolemmal transmembrane glycoproteins that interact with dystrophin, probably to provide a link between the membrane associated cytoskeleton and the extracellular matrix. Defects in the protein can lead to early onset autosomal recessive muscular dystrophy, in particular limb-girdle muscular dystrophy, type 2C (LGMD2C). [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-11228
Species: Hu
NBP1-89333
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB100-230
Species: Hu
Applications: WB, IP, PLA
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB100-233
Species: Hu
Applications: WB, PLA
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP2-25196
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, In vitro, CyTOF-ready
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
NBP2-34234
Species: Hu
Applications: ICC/IF, IHC-Fr, IHC-P
NBP1-90297
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
H00728695-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47829
Species: Hu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P, IP
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-83013
Species: Hu
Applications: WB, IHC, IHC-P

Publications for gamma Sarcoglycan Partial Recombinant Protein (H00006445-Q01) (0)

There are no publications for gamma Sarcoglycan Partial Recombinant Protein (H00006445-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for gamma Sarcoglycan Partial Recombinant Protein (H00006445-Q01) (0)

There are no reviews for gamma Sarcoglycan Partial Recombinant Protein (H00006445-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for gamma Sarcoglycan Partial Recombinant Protein (H00006445-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional gamma Sarcoglycan Products

Bioinformatics Tool for gamma Sarcoglycan Partial Recombinant Protein (H00006445-Q01)

Discover related pathways, diseases and genes to gamma Sarcoglycan Partial Recombinant Protein (H00006445-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for gamma Sarcoglycan Partial Recombinant Protein (H00006445-Q01)

Discover more about diseases related to gamma Sarcoglycan Partial Recombinant Protein (H00006445-Q01).
 

Pathways for gamma Sarcoglycan Partial Recombinant Protein (H00006445-Q01)

View related products by pathway.

Blogs on gamma Sarcoglycan

There are no specific blogs for gamma Sarcoglycan, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human gamma Sarcoglycan Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SGCG