Galectin-10 Antibody

Images

 
Western Blot: Galectin-10 Antibody [NBP1-87688] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line HL-60
Immunohistochemistry-Paraffin: Galectin-10 Antibody [NBP1-87688] - Staining of human bone marrow shows strong cytoplasmic positivity in subsets of hematopoietic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Galectin-10 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LACFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYGAWKQQVESKNMPFQDGQEFELSISVLPDKYQVM
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CLC
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:250 - 1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Galectin-10 Protein (NBP1-87688PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Galectin-10 Antibody

  • Charcot-Leyden crystal proteinLGALS10A
  • CLC
  • EC 3.1.1.5
  • eosinophil lysophospholipase
  • GAL10
  • Gal-10
  • galectin 10
  • Galectin10
  • Galectin-10
  • LGALS10
  • LPPL_HUMAN
  • Lysolecithin acylhydrolase
  • MGC149659

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-19809
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33582
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF1152
Species: Hu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-19928
Species: Hu
Applications: WB, IHC, IHC-P
AF1339
Species: Hu
Applications: WB, Simple Western, IHC, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP1-82693
Species: Hu
Applications: WB, IHC, IHC-P
AF1227
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
557-NT/CF
Species: Rt
NBP2-32964
Species: Hu
Applications: Flow, ICC/IF, IHC-Fr
NBP1-69123
Species: Hu, Mu, Rt
Applications: WB
H00001188-P01
Species: Hu
NBP2-46842
Species: Hu
Applications: IHC, IHC-P
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP1-22568
Species: Hu
Applications: IHC-P
NBP1-69124
Species: Mu, Rt
Applications: WB, IHC
NBP1-91872
Species: Hu
Applications: IHC, IHC-P
NBP2-33778
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87688
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Galectin-10 Antibody (NBP1-87688) (0)

There are no publications for Galectin-10 Antibody (NBP1-87688).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Galectin-10 Antibody (NBP1-87688) (0)

There are no reviews for Galectin-10 Antibody (NBP1-87688). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Galectin-10 Antibody (NBP1-87688). (Showing 1 - 1 of 1 FAQ).

  1. We ordered Galectin 10 Antibody (NBP1-87688) with the Lot-Nr. R38892. We just don't have the vial label any more. Could you please tell me the concentration of our lot?
    • The concentration of NBP1-87688, lot number R38892 is 0.2 mg/ml.

Secondary Antibodies

 

Isotype Controls

Additional Galectin-10 Products

Bioinformatics Tool for Galectin-10 Antibody (NBP1-87688)

Discover related pathways, diseases and genes to Galectin-10 Antibody (NBP1-87688). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Galectin-10 Antibody (NBP1-87688)

Discover more about diseases related to Galectin-10 Antibody (NBP1-87688).
 

Pathways for Galectin-10 Antibody (NBP1-87688)

View related products by pathway.

PTMs for Galectin-10 Antibody (NBP1-87688)

Learn more about PTMs related to Galectin-10 Antibody (NBP1-87688).

Blogs on Galectin-10

There are no specific blogs for Galectin-10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Galectin-10 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CLC
Entrez