GALE Antibody

Images

 
Western Blot: GALE Antibody [H00002582-D01P] - Analysis of GALE expression in transfected 293T cell line by GALE polyclonal antibody.Lane 1: GALE transfected lysate(38.30 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GALE Antibody Summary

Immunogen
GALE (NP_000394.2, 1 a.a. - 348 a.a.) full-length human protein. MAEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRRVQELTGRSVEFEEMDILDQGALQRLFKKYSFMAVIHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMKAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADKTWNAVLLRYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSVLQMVQAMEKASGKKIPYKVVARREGDVAACYANPSLAQEELGWTAALGLDRMCEDLWRWQKQNPSGFGTQA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GALE
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB and Functional.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GALE Antibody

  • EC 5.1.3
  • EC 5.1.3.2
  • FLJ95174
  • FLJ97302
  • Galactowaldenase
  • short chain dehydrogenase/reductase family 1E, member 1
  • UDP galactose-4'-epimerase
  • UDP-
  • UDP-galactose 4-epimerase
  • UDP-galactose-4-epimerase
  • UDP-glucose 4-epimerase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81853
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00002592-M01
Species: Hu, Rt
Applications: WB, ELISA, IHC-P
NBP2-33582
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-82693
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-57614
Species: Hu
Applications: ICC/IF
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59448
Species: Hu
Applications: WB
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP2-49365
Species: Hu
Applications: ICC/IF, IHC
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
H00029956-M01A
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
NBP2-20214
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF5447
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
NBP1-91823
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00002582-D01P
Species: Hu
Applications: WB

Publications for GALE Antibody (H00002582-D01P) (0)

There are no publications for GALE Antibody (H00002582-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GALE Antibody (H00002582-D01P) (0)

There are no reviews for GALE Antibody (H00002582-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GALE Antibody (H00002582-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GALE Products

Bioinformatics Tool for GALE Antibody (H00002582-D01P)

Discover related pathways, diseases and genes to GALE Antibody (H00002582-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GALE Antibody (H00002582-D01P)

Discover more about diseases related to GALE Antibody (H00002582-D01P).
 

Pathways for GALE Antibody (H00002582-D01P)

View related products by pathway.

PTMs for GALE Antibody (H00002582-D01P)

Learn more about PTMs related to GALE Antibody (H00002582-D01P).
 

Research Areas for GALE Antibody (H00002582-D01P)

Find related products by research area.

Blogs on GALE

There are no specific blogs for GALE, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GALE Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GALE
Uniprot