Galanin Antibody (3C1-G5) Summary
Immunogen |
GAL (AAH30241, 1 a.a. ~ 123 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MARGSALLLASLLLAAALSASAGLWSPAKEKRGWTLNSAGYLLGPHAVGNHRSFSDKNGLTSKRELRPEDDMKPGSFDRSIPENNIMRTIIEFLSFLHLKEAGALDRLLDLPAAASSEDIERS |
Specificity |
GAL - galanin |
Isotype |
IgG2a Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
GAL |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Sandwich ELISA
- Western Blot 1:500
|
Application Notes |
Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
Reactivity Notes
Human. Other species not tested.
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Galanin Antibody (3C1-G5)
Background
Galanin occurs in nerve fibers in most parts of the gastrointestinal tract and in nerve cell bodies in both the submucous and the myenteric plexus. Galanin has multiple effects on gut smooth muscle. Absorption with 10-100mg galanin 1-29 per ml diluted antiserum abolishes the staining, while galanin 1-10, VIP, NPY and Substance P do not.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Pm
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rb, Rt, Xp
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: IHC
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, ICFlow, WB
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Ca, Hu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: IHC, IHC-P, IP, WB (-)
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ELISA, S-ELISA
Publications for Galanin Antibody (H00051083-M01) (0)
There are no publications for Galanin Antibody (H00051083-M01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Galanin Antibody (H00051083-M01) (0)
There are no reviews for Galanin Antibody (H00051083-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Galanin Antibody (H00051083-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Galanin Products
Bioinformatics Tool for Galanin Antibody (H00051083-M01)
Discover related pathways, diseases and genes to Galanin Antibody (H00051083-M01). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for Galanin Antibody (H00051083-M01)
Discover more about diseases related to Galanin Antibody (H00051083-M01).
| | Pathways for Galanin Antibody (H00051083-M01)
View related products by pathway.
|
PTMs for Galanin Antibody (H00051083-M01)
Learn more about PTMs related to Galanin Antibody (H00051083-M01).
| | Research Areas for Galanin Antibody (H00051083-M01)
Find related products by research area.
|
Blogs on Galanin