Galanin Antibody (3C1-G5)

Images

 
Western Blot: Galanin Antibody (3C1-G5) [H00051083-M01] - Analysis of GAL expression in transfected 293T cell line by GAL monoclonal antibody (M01), clone 3C1-G5.Lane 1: GAL transfected lysate (Predicted MW: 13.3 ...read more
Sandwich ELISA: Galanin Antibody (3C1-G5) [H00051083-M01] - Detection limit for recombinant GST tagged GAL is 3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3C1-G5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Galanin Antibody (3C1-G5) Summary

Immunogen
GAL (AAH30241, 1 a.a. ~ 123 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MARGSALLLASLLLAAALSASAGLWSPAKEKRGWTLNSAGYLLGPHAVGNHRSFSDKNGLTSKRELRPEDDMKPGSFDRSIPENNIMRTIIEFLSFLHLKEAGALDRLLDLPAAASSEDIERS
Specificity
GAL - galanin
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GAL
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Galanin Antibody (3C1-G5)

  • GAL
  • GAL1
  • galanin prepropeptide
  • Galanin
  • GALN
  • GALNgalanin-related peptide
  • GLNNgalanin-message-associated peptide
  • GMAP
  • MGC40167

Background

Galanin occurs in nerve fibers in most parts of the gastrointestinal tract and in nerve cell bodies in both the submucous and the myenteric plexus. Galanin has multiple effects on gut smooth muscle. Absorption with 10-100mg galanin 1-29 per ml diluted antiserum abolishes the staining, while galanin 1-10, VIP, NPY and Substance P do not.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Galanin Antibody (H00051083-M01) (0)

There are no publications for Galanin Antibody (H00051083-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Galanin Antibody (H00051083-M01) (0)

There are no reviews for Galanin Antibody (H00051083-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Galanin Antibody (H00051083-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Galanin Products

Research Areas for Galanin Antibody (H00051083-M01)

Find related products by research area.

Blogs on Galanin

There are no specific blogs for Galanin, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Galanin Antibody (3C1-G5) and receive a gift card or discount.

Bioinformatics

Gene Symbol GAL
Entrez
OMIM
Uniprot